PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g23360.2
Common NameLR48_Vigan02g044500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 146aa    MW: 15850 Da    PI: 9.5323
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g23360.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like55.61.1e-172342355
         G2-like 23 GsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Vang06g23360.2  2 GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 34
                    99******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015572.2E-13134IPR006447Myb domain, plants
SuperFamilySSF466892.33E-9138IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-17139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
LGIKNAVPKT IMQLMSVDGL TRENVASHLQ KYRLYLKRMQ GLAGGSAADS ATDHLFASSP  60
VPPHFLHPAT RPASDHYLPF VPGLQQHRNH HHHQHMAVPA HFGSPRNAHF ELPVLSRMGA  120
SVPGYVEDVE SGGRKVLTLF PAGDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A6e-181372157Transcription factor LUX
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang06g23360.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017413418.11e-102PREDICTED: transcription factor PCL1-like
TrEMBLA0A0L9TUQ81e-101A0A0L9TUQ8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SU301e-101A0A0S3SU30_PHAAN; Uncharacterized protein
STRINGXP_007145504.11e-83(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.13e-41G2-like family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]