PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g23360.1
Common NameLR48_Vigan02g044500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 209aa    MW: 22935.2 Da    PI: 9.82
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g23360.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.69e-314497155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Vang06g23360.1 44 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 97
                    59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.43E-2041101IPR009057Homeodomain-like
PROSITE profilePS5129411.05941100IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-3143102IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-244597IPR006447Myb domain, plants
PfamPF002496.2E-84796IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MPLSQTLISP HLAVAFDITN SSHHQFPLQP PSAAEDEPAR TLKRPRLVWT PQLHKRFVDA  60
VAHLGIKNAV PKTIMQLMSV DGLTRENVAS HLQKYRLYLK RMQGLAGGSA ADSATDHLFA  120
SSPVPPHFLH PATRPASDHY LPFVPGLQQH RNHHHHQHMA VPAHFGSPRN AHFELPVLSR  180
MGASVPGYVE DVESGGRKVL TLFPAGDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-3344100157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang06g23360.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017413418.11e-151PREDICTED: transcription factor PCL1-like
SwissprotO222102e-51MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A0L9TUQ81e-149A0A0L9TUQ8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SU301e-149A0A0S3SU30_PHAAN; Uncharacterized protein
STRINGXP_007145504.11e-124(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.14e-68G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]
  2. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]