PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g07140.1
Common NameLR48_Vigan02g191300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 95aa    MW: 10571.1 Da    PI: 4.1591
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g07140.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26042.32.1e-1314061100
          DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                     +vyeA+ar+rdPvyG++g i +lq+q+++l+a+la++++e
  Vang06g07140.1   1 MVYEANARIRDPVYGCAGAICQLQKQVSELQAQLAKAQAE 40 
                     69**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.7E-11138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.466141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MVYEANARIR DPVYGCAGAI CQLQKQVSEL QAQLAKAQAE VVNIQCQQAN LVALICMEMS  60
ETQEQHMVQP QPHIDMSCFI EDNSFGTAWE PLWT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang06g07140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-158AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017414151.12e-65PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-27LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0L9TYU24e-64A0A0L9TYU2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SNT94e-64A0A0S3SNT9_PHAAN; Uncharacterized protein
STRINGGLYMA20G31780.15e-60(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3734122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-22LOB domain-containing protein 1
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]