PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g06220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 385aa    MW: 42793.4 Da    PI: 7.6616
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g06220.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.6e-32211266156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+++LH+rF++a++qLGG++ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Vang06g06220.1 211 KQRRCWSQDLHKRFLHALQQLGGADSATPKQIRELMNVDGLTNDEVKSHLQKYRLH 266
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.598208268IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-29209269IPR009057Homeodomain-like
SuperFamilySSF466893.17E-18209269IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-27211266IPR006447Myb domain, plants
PfamPF002492.4E-7213264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MYFFTEKMQR LKLGFPDYIQ ALEEERRKIQ VFCKELPLSF ELVTQAIEAC RQQLSGTTSE  60
YNLNGQSECS ERTTSSEGPV LEEFIPIKKR ASSSPCCDED DEDYEQHSLR QTVLNENNNN  120
SDKRKSDWLR SVQLWNPDPP AEEDATKKVP GMELKRSGSG GGAFQPFHRE ERATKETETL  180
YKAPSSTRVP AASSSAGELT PEKNQNEGQR KQRRCWSQDL HKRFLHALQQ LGGADSATPK  240
QIRELMNVDG LTNDEVKSHL QKYRLHTRRP SPLVHNNSSP QAAPFVLVGN IFVQSPEYAA  300
VATSTASREV TTVTAPAGVY APVATHPKPV SQPSADSIKK PQFKKFKHSE HSNSNERGHH  360
SEGAVHSNSP TSSSSTHTSA SPGY*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang06g06220.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311960.0KT031196.1 Glycine max clone HN_CCL_161 MYB/HD-like transcription factor (Glyma10g34780.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017412612.10.0PREDICTED: myb family transcription factor EFM-like
SwissprotQ9FPE88e-90HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A0S3SP020.0A0A0S3SP02_PHAAN; Uncharacterized protein
STRINGXP_007143802.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-89G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]