PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g05210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CPP
Protein Properties Length: 802aa    MW: 88100.7 Da    PI: 6.342
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g05210.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.4e-16512550240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Vang06g05210.1 512 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCRDCFNKP 550
                     689**********************************96 PP

2TCR505.8e-16597636140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN+ 
  Vang06g05210.1 597 RHKRGCNCKKSSCLKKYCECYQGGVGCSISCRCEGCKNTY 636
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.2E-19511552IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.747512637IPR005172CRC domain
PfamPF036381.7E-11514549IPR005172CRC domain
SMARTSM011142.6E-17597638IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.6E-11599635IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 802 aa     Download sequence    Send to blast
LQMDTPDRSK INTPLSQFED SPVFNYISNL SPIEPVKSVH ITQTFNSLSF SSPPSVFTSP  60
HVNCHRESRF LRRHNLLDAS KGKGSSEDIN NVYSCEKTPA DSTQPCHESS EPQENTNPNI  120
SIRDASIEPC DENPNISIEV PQGLKYNLAS PGYEPVICAD EADSLLELPG KPGSDVSYVP  180
DDSEKDSIEG EMHLPALCQN EEKIEGPNCG VDDLINEASD LLMFSPPNMK EAFKDINKQL  240
NPSTKLTNLR TLLRQSATND GHQMHIVDTV ASGSEHEIEN HPCESGAATD TVQRQDKHNN  300
VALVASNPIE KVDDKLVYVT HRGIRRRCLD FEMASVQRKN LDGKSNTNSS AEKSDEMDVS  360
KGKQLLPIKH SGDSRKCVLP GIGLHLNALA SLNDCKNIKI ETLLSGRQPN LPSSSSSLQL  420
SASQDHQLSL VPTSVEKDME QSDNEVQPGE DCTQPLVHMP GEDCTQPLVH MPGEDCTQPL  480
VHMPGEDFQQ NSPKKKRQIY RRRLEQDGEG ESCKRCNCKK SKCLKLYCEC FAAGVYCIEP  540
CSCRDCFNKP IHVDTVLQTR QQIESRNPLA FAPKVIRSSD SVPEIGDDPN KTPASARHKR  600
GCNCKKSSCL KKYCECYQGG VGCSISCRCE GCKNTYGRKD GSVHSGIEAK PEEETEACER  660
GVMENASHKT ETQNTEDHLD HALPTTPLRL SRSLIPLPFS SKGKPPRSFV TTISSSGLFV  720
SQKLGKSSAP RSQPKFEMPV QTVPDDDSPV TCIKTSSPNG KRISSPNCDV GSSPTRRGGR  780
KLILQSIPSF PSLTPHNLRS D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-1651663414120Protein lin-54 homolog
5fd3_B6e-1651663414120Protein lin-54 homolog
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang06g05210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017415443.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
TrEMBLA0A0S3SMQ40.0A0A0S3SMQ4_PHAAN; Uncharacterized protein
STRINGXP_007143298.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-110TESMIN/TSO1-like CXC 2