PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g04690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 784aa    MW: 85573.4 Da    PI: 5.4195
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g04690.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.35.3e-08891152956
                     HHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  29 ereeLAkklgLterqVkvWFqNrRakek 56 
                     +++eL ++lgL+ +qVk+WFqNrR+++k
  Vang06g04690.1  89 QIQEL-ESLGLENKQVKFWFQNRRTQMK 115
                     66666.789****************999 PP

2START158.94e-502705192206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                     la++a++el+k+ +ae+p+W ks     e  n +e+ + f++  +     + +ea r++g+v+ ++  lve+l+d + +W e+++    +a  l+
  Vang06g04690.1 270 LALAAMEELLKMTQAESPLWIKSLdgekEVFNHEEYARLFSPCIGpkptgYVTEATRETGIVIINSLALVETLMDAN-RWAEMFPsmiaRAINLD 363
                     6899********************876666688999999999888********************************.*******99999999** PP

                     EECTT...............................EEEE.EEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE- CS
           START  84 vissg...............................galq.lmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRa 145
                     vis+g                                ++  +m ae q+lsplvp R + f+R+++q+ +g+w++vdvS+d+  +  + ++++ +
  Vang06g04690.1 364 VISNGmggtrngalqvvgffavymldfvlivagtddQDYSfQMHAEVQLLSPLVPvRQVRFIRFCKQHAEGVWAVVDVSIDVGHDAANAQPFMSC 458
                     *********************************99955552788999**************************************999******* PP

                     EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 146 ellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++lpSg+++++++ng+skvtw+eh++++++ +h+l+r+l++sg+ +ga +w atlqrqce+
  Vang06g04690.1 459 RRLPSGCIVQDMPNGYSKVTWLEHWEYDESGVHQLYRPLLSSGVGFGAHRWIATLQRQCEC 519
                     ***********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-1063117IPR009057Homeodomain-like
SMARTSM003890.00977121IPR001356Homeobox domain
CDDcd000863.62E-778117No hitNo description
Gene3DG3DSA:1.10.10.601.4E-683121IPR009057Homeodomain-like
PfamPF000461.5E-589115IPR001356Homeobox domain
PROSITE profilePS5007110.13994117IPR001356Homeobox domain
PROSITE profilePS5084839.428260522IPR002913START domain
SuperFamilySSF559619.42E-29262370No hitNo description
CDDcd088751.16E-113264518No hitNo description
SMARTSM002341.4E-23269519IPR002913START domain
PfamPF018525.5E-41270519IPR002913START domain
SuperFamilySSF559619.42E-29404519No hitNo description
SuperFamilySSF559612.75E-21547777No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
LIIISQSISS SMQNSSSFSY SNQRKMEGPS EMGLIGENFD AGLMGRMRDD EYESRSGSDN  60
FDGVSGDDQD GGDDQPQRKK RYHRHTPHQI QELESLGLEN KQVKFWFQNR RTQMKTQLER  120
HENIMLRQEN DKLRAENSLM KEAMSNPVCN SCGGPAIPGQ ISFEEHQIRI ENARLKDELN  180
RICALANKFL GKPISSMTGP MALPTSNSGL ELGIGRSGLG GSSTLGTPLP MGLDLGDGVL  240
GTQTGMPGIR PSLGLMGNEV QLERSMLIDL ALAAMEELLK MTQAESPLWI KSLDGEKEVF  300
NHEEYARLFS PCIGPKPTGY VTEATRETGI VIINSLALVE TLMDANRWAE MFPSMIARAI  360
NLDVISNGMG GTRNGALQVV GFFAVYMLDF VLIVAGTDDQ DYSFQMHAEV QLLSPLVPVR  420
QVRFIRFCKQ HAEGVWAVVD VSIDVGHDAA NAQPFMSCRR LPSGCIVQDM PNGYSKVTWL  480
EHWEYDESGV HQLYRPLLSS GVGFGAHRWI ATLQRQCECL AILMSSSISS DDHTALSQAG  540
RRSMLKLAQR MTSNFCSGVC ASSARKWDML HIGTLGDDMK VMTRKNVDDP GEPPGIVLSA  600
ATSVWMPVSR QRVFDFLRDE RLRSEWDILS NGGPMQEMVH IAKGQGHGNC VSLLRANAVN  660
ANDSSMLILQ ETWMDASCSV VVYAPVDVQS LNVVMSGGDS AYVALLPSGF AIVPDGHCNN  720
STCNGTMQKG GGGEDSGGSL LTVGFQILVN SLPTAKLTVE SVDTVNNLIS CTIQKIKGAL  780
RVA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang06g04690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017415466.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0S3SN040.0A0A0S3SN04_PHAAN; Uncharacterized protein
STRINGXP_007143378.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]