PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g00280.1
Common NameLR48_Vigan02g254100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 323aa    MW: 35731.2 Da    PI: 6.9067
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g00280.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1049e-332982255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWtpeLH++Fv+a+++LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Vang06g00280.1 29 PRLRWTPELHRCFVHAIDSLGGHQKATPKLVLQLMDVKGLTISHVKSHLQMYRS 82
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.9012585IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-312584IPR009057Homeodomain-like
SuperFamilySSF466891.74E-152782IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-232982IPR006447Myb domain, plants
PfamPF002491.1E-73081IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
LLCIYKIKLN MGSCGREGAV RQYIRSKVPR LRWTPELHRC FVHAIDSLGG HQKATPKLVL  60
QLMDVKGLTI SHVKSHLQMY RSMRGDLGRQ GRTHSQHRNQ SFEEHDDGCV DEVNDVCVEY  120
SCSKPMGIES DSFFGHSNLP PKRARIETRS SISESLQCSQ RLCDAVPNPY CFYDYLQKPM  180
AEHKGIKEFC KASTWQTQPH SSLLLPHFPT LTSFQCPNQQ SDFLQVTTLN EGKSSGKGIN  240
VDVNTETGEA EVEDVGGYEL SLSLTLPNPS PQRSNCSCSG SEISETISSC PAAGFSNYKD  300
CTSSSNLNET INLDLSLALC GN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-213084458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-213084458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-213084357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-213084357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-213084357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-213084357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-213084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-213084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-213084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-213084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-213084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-213084458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang06g00280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0982250.0BT098225.1 Soybean clone JCVI-FLGm-16F9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017413879.10.0PREDICTED: uncharacterized protein LOC108325332
TrEMBLA0A0L9U0U50.0A0A0L9U0U5_PHAAN; Uncharacterized protein
STRINGXP_007142823.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-35G2-like family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]