PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0697s00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 343aa    MW: 38452.4 Da    PI: 7.3388
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0697s00020.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-312074155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprl+WtpeLH+rF ea++qLGG+ekAtPk+++++m+++gLtl+h+kSHLQkYRl
  Vang0697s00020.1 20 KPRLKWTPELHQRFTEAINQLGGAEKATPKSLMRVMGIPGLTLYHLKSHLQKYRL 74
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-291874IPR009057Homeodomain-like
SuperFamilySSF466893.23E-161976IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-222075IPR006447Myb domain, plants
PfamPF002498.9E-82273IPR001005SANT/Myb domain
PfamPF143795.9E-23119165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MDLQNVENRT MRLVLSTDAK PRLKWTPELH QRFTEAINQL GGAEKATPKS LMRVMGIPGL  60
TLYHLKSHLQ KYRLGKNSPP ETCSDNKQQG FSDIQSSDVR CSREISIRTQ NQMNDRSLKI  120
AEALQMQMEV QRKLYEQIEV QRHLQLRIEA QGKYLQSVLS KAHETLARYD SSTTGIELAK  180
SELSQLVSII NNACPTSPVS ELTETRGMSL NCGEMKQDRG TMCSLESSLT SSESSGRTEV  240
RQALDEAEKP QKTNGISVEL PLMEIHQEGT AFKGYTSEWR KRSAATDSSG CCVDQPCGKK  300
CGNKLRKCEL SDMLDLNSQY ERDIDSSVKE IDLNCSSSFW GQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0697s00020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017424791.10.0PREDICTED: myb family transcription factor PHL8-like
SwissprotF4I2747e-75PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLA0A0S3R1K20.0A0A0S3R1K2_PHAAN; Uncharacterized protein
STRINGXP_007158649.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.22e-79G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]