PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g10750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CPP
Protein Properties Length: 513aa    MW: 56976.4 Da    PI: 7.9773
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g10750.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.76.5e-15130169242
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++k+CnCk+s+Clk+YCeCfaag +C+  C+C +C+N+e++
  Vang05g10750.1 130 KQKQCNCKNSRCLKLYCECFAAGIYCDG-CNCVNCHNNEDN 169
                     89**************************.*********975 PP

2TCR51.22.6e-16212251140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Vang05g10750.1 212 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 251
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-18129169IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.193130252IPR005172CRC domain
PfamPF036387.0E-12131167IPR005172CRC domain
SMARTSM011148.4E-20212253IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.5E-13215250IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MEPSETTSDS VPRKLARQLD FTVVYRDHPH LKLPPQSLPP HSLLPLSWHP PLHLNLQTPG  60
QRPWLCLESQ EPQEQQPWLH SLRPKLVSPV GRFPQPVQKL PVKVLQEVKS ESPISQRPFN  120
VELKDTTPKK QKQCNCKNSR CLKLYCECFA AGIYCDGCNC VNCHNNEDNE AARQEAVGIT  180
LERNPNAFRP KIASSPQEQR NSKESEAQVI GKHNKGCHCK KSGCLKKYCE CFQANILCSE  240
NCKCMDCKNF EGSTERRAIF HREYSLVHIK QGTNAAVTEV VGSSGYRKYI TPKRRKIHES  300
FSGKSAADQT VNTTGQYLQE TDRMASSSST LSYSFVSDHV NTRISGSSRS VYLSVLADVL  360
QPQNVKNLCS LFVILSGVSA KTDAEAEGKI DRQTKAENSK ASVASSAKSL QETKDGRQPV  420
CDDDVNKAVA DAVDIANYNR PLSPETLALM CDEQDNMFFG NTSADGAAYQ NMIQKSLNSD  480
ESSDAYGEQE RLIMTKLLDV LRELVTLGSI KG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-301222612132Protein lin-54 homolog
5fd3_B4e-301222612132Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang05g10750.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017409175.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
TrEMBLA0A0S3RCW80.0A0A0S3RCW8_PHAAN; Uncharacterized protein
STRINGXP_007137192.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF151511113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-114Tesmin/TSO1-like CXC domain-containing protein