PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g06300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRF
Protein Properties Length: 356aa    MW: 39622.7 Da    PI: 6.6471
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g06300.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.37.5e-25103147145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  Vang05g06300.1 103 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVES 147
                     79****************************************986 PP

2QLQ61.71.9e-212056137
             QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    s+FT +Q+++L++Q+l++Ky++a++PvP++L+++iqk
  Vang05g06300.1 20 SPFTVSQWEELEHQALIFKYMLAGLPVPQNLVLPIQK 56
                    89*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.5E-122056IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-152155IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.132156IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.762103147IPR014977WRC domain
PfamPF088793.3E-21104146IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MNNSGGGTLM GLSNGYYGRS PFTVSQWEEL EHQALIFKYM LAGLPVPQNL VLPIQKSFNS  60
IPHAFFHHPT CQFSNPVSFL SGDFEPISYV KLSYCSFYGK KVDPEPGRCR RTDGKKWRCS  120
KEAYPDSKYC ERHMHRGRNR SRKPVESQTM TQSSSTVTTL DVTGGSGSSR TVNFQNLPAN  180
AVGNLQGTDS GTDHTSYHLD SIPYAIPSKE YRYLQGLKSE GGEHIFFSEA SGSSKVLQME  240
SQQLEDTWSL MSNKVASFST SKSSNDSLLH SDYPQNSFLS GEYASEEHLK EEGQSLRPFF  300
NEWPKGRDSW SGLEDERSNQ AAFSTTQLSI SIPMSSDISA TSSQSPHGEN EIQFR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523171.10.0PREDICTED: growth-regulating factor 4-like
TrEMBLA0A0L9V8F90.0A0A0L9V8F9_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SEF40.0A0A0S3SEF4_PHAAN; Uncharacterized protein
STRINGGLYMA11G11826.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47812951
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-42growth-regulating factor 5