PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g00890.1
Common NameLR48_Vigan04g250300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SRS
Protein Properties Length: 116aa    MW: 12482.8 Da    PI: 5.5298
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g00890.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70267.44.7e-21243113154
          DUF702 113 avfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     a+frcv+v+svdd+ +e+aYqt+v+igGhvf+GiLydqG+e+
  Vang05g00890.1   2 AMFRCVQVRSVDDAVNEIAYQTSVNIGGHVFSGILYDQGPEQ 43 
                     99**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR016242.3E-19241IPR006511Lateral Root Primordium type 1, C-terminal
PfamPF051423.1E-17242IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MAMFRCVQVR SVDDAVNEIA YQTSVNIGGH VFSGILYDQG PEQNYNINKG ESSTALVDEH  60
QNNSLGLVKN SSSRDSSGVT IASAGHGDPL FPPPPYPFPL ASFRPGMPYF TYPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014499411.12e-57PREDICTED: protein SHI RELATED SEQUENCE 3-like
TrEMBLA0A0L9UHB61e-80A0A0L9UHB6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RA683e-81A0A0S3RA68_PHAAN; Uncharacterized protein
STRINGGLYMA04G01125.14e-41(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2269234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.11e-15SHI-related sequence 5
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]