PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g00830.1
Common NameLR48_Vigan04g250000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GATA
Protein Properties Length: 259aa    MW: 28813.6 Da    PI: 8.7028
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g00830.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.32.1e-18176209134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Vang05g00830.1 176 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 209
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.7E-12170224IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-13170231No hitNo description
PROSITE profilePS5011411.411170206IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-14174207IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.81E-13175232No hitNo description
PROSITE patternPS003440176201IPR000679Zinc finger, GATA-type
PfamPF003202.9E-16176209IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MEVAVAKALK PSLRREFIVQ QTHCEDFFSL NANTVAGGDD FSVDDLFDFS DGSLHYEPQE  60
YAGDLEDLEW VSHFVDDSLP ELSLLYPVRP EEVNRRVEPE PSAKKTPRFP CETKITTKTR  120
TVRNRKPNAR VWSLGPLLSL PSSPSSCSSS STEPPAKKQK KRAEAQPVGA QVQRRCSHCQ  180
VQKTPQWRTG PLGAKTLCNA CGVRYKSGRL FSEYRPACSP TFCSDIHSNS HRKVLEIRKK  240
KGVSGPEAHP QAQMVPTC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502491.11e-155PREDICTED: GATA transcription factor 7-like
RefseqXP_014502492.11e-155PREDICTED: GATA transcription factor 7-like
SwissprotO655153e-50GATA7_ARATH; GATA transcription factor 7
TrEMBLA0A0L9UIA51e-170A0A0L9UIA5_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RA081e-170A0A0S3RA08_PHAAN; Uncharacterized protein
STRINGGLYMA06G01110.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.12e-43GATA transcription factor 7
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]