PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang04g16060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HB-other
Protein Properties Length: 1067aa    MW: 118694 Da    PI: 9.2273
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang04g16060.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.28.8e-0669125157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++ ++ +++ F  +  +s++e +e+++  g+t +qV+ +F  +R + ++
  Vang04g16060.1  69 KRPRDLLNPKAVNYMQSIFSIKDSISKKELREISALFGVTATQVRDFFTGQRSRVRR 125
                     799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-565120IPR009057Homeodomain-like
PROSITE profilePS500719.76666126IPR001356Homeobox domain
SMARTSM003893.9E-468130IPR001356Homeobox domain
CDDcd000861.71E-469125No hitNo description
SuperFamilySSF466893.25E-669130IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.103.2E-5226310IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476765.23E-5230309IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1067 aa     Download sequence    Send to blast
MDAWNEDFAE QEIGNSAESF QKFLLSQRDL FHSQIDQFQE IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSIFSIK DSISKKELRE ISALFGVTAT QVRDFFTGQR  120
SRVRRLVQLS KERALGSNSC EDPHDDKIIP DPVRLINPAS VNSTVPSNAE EASCSTQDAA  180
LPDLDDSDKH FVDNIFSLMQ QEETFSGQER LMEWILTIQN FSVLLWFLSR GGGITLATWL  240
SKATAEEQTS VLLLILKVLC HLPLHKAIPM HISAILQSVN KLRFYRTSDI SNRARILLSK  300
WSKLLARNQV IKKPNGVRPS SDGHKELICQ RQACILFSMN NLFRHSFSII MVSTFCSIGQ  360
FVGSESWHSN IDVPEDFLSL SSESLDNFRK VGSPQAAKLL PPSLDDSNKK STLGVISSRI  420
LVFAISLFYS LTPLTESRER RKVQLVEQPG QKSVSRSSQV TRAGSVSQGR PMSADDIQKA  480
KMRALFMQSK YGKSSSKESK ETKIDSLNKQ PQTIPASIAA CSSKVPTPPK IDENKKPLLL  540
ASKTSNRLEA YSKPKVDVKE PLWEKCTRIQ IPWKTPAEVE LKDSWSVGGG ENSKEVDVQR  600
NRDRREKETI YKTIQEIPPN PKEPWDLEMD YDDTLTLEIP IEQLPDGDGA DITVSPNQVA  660
EHTVQGVAST SSTSVAPAEP DLELLAVLLK NPELVFALTS GQAGSIPGED VVKLLDMIKR  720
GGANLGLSEN TNGSYGTSVK APDKVEVSLP SPTPLSDPRT NGWSSEASKN PFSRRSVASD  780
RIIQNHAAVT TTNLLTQIPM TSTTALRQQP AVVVSSSRHL SSTTVSPYSL HQATNVNPEK  840
QQPLGHVQIP SSNVGLTMKK NLITTNAPSV NYSGTHSAVA MRGNGTNYVK PVHSMSVQHE  900
GVSNSFPQSS FKLPSPTPSN SASQQQRHQQ HIVQEAHYTE PPYRNPSRSY PPQTEKSDHG  960
SESAWRIRQD VPFSSQRNPN NYNTMVGGSR QSGFWDRNNQ GGEDFESWSP ENSPTRNPRY  1020
MPGRNYPDSR VNHGRNHRPE WSRQRGSSEH WDPDRQGNRK WHDQRR*
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang04g16060.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017418614.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-153LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A0S3S0N00.0A0A0S3S0N0_PHAAN; Uncharacterized protein
STRINGXP_007163082.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-129HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]