PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang04g13640.2
Common NameLR48_Vigan03g205000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 278aa    MW: 30499 Da    PI: 7.8682
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang04g13640.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.72.6e-3346100155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Vang04g13640.2  46 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 100
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.88443103IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-3244101IPR009057Homeodomain-like
SuperFamilySSF466893.4E-1745100IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-2646101IPR006447Myb domain, plants
PfamPF002491.4E-74899IPR001005SANT/Myb domain
PfamPF143799.8E-25134180IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MYHAKKFPSA SMVPYKSQGG AEQIANVEVL GGSAGKNATP AEGSGKQRLR WTSDLHDRFV  60
DAITQLGGPD RATPKGVLRV MGVPGLTIYH VKSHLQKYRL AKYLPESPAD GKDSKDEKRN  120
SGDSFSGADS SPGMPINDAL RMQMEVQKRL HEQLEVQKQL QMRIEAQGKY LQKIIEEQQK  180
LGNTLTTSET LPLSHDKQTH PHSEASGSSD ALASTLSPRK KQRIDDGSKD GFTASHVRKT  240
EQKNECNVGQ LDPNLYDDAG FGFDLETNKD EHKESGQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang04g13640.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ0073110.0HQ007311.1 Glycine max cultivar Jidou11 MYB transcription factor (PHR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017416066.10.0PREDICTED: myb family transcription factor PHL7-like isoform X1
SwissprotQ9SJW01e-70PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A0L9U7880.0A0A0L9U788_PHAAN; Uncharacterized protein
STRINGXP_007161823.10.0(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-73G2-like family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]