PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang04g08830.1
Common NameLR48_Vigan404s004100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 314aa    MW: 35278.1 Da    PI: 6.5851
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang04g08830.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.4e-3264117255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH rFv+av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Vang04g08830.1  64 PRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 117
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-2960118IPR009057Homeodomain-like
PROSITE profilePS5129412.92960120IPR017930Myb domain
SuperFamilySSF466899.5E-1563118IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-2364119IPR006447Myb domain, plants
PfamPF002491.1E-965116IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEEERHVSEC SKTSPSNEEG CEESEEENED ESKQNNNGGS SSNSTVEENE KKATVRPYVR  60
SKLPRLRWTP DLHLRFVHAV QRLGGQERAT PKLVLQLMNI KGLSIAHVKS HLQMYRSKKV  120
EANQGRIRYG YGDASLAIYE NMVKTCMNRS SVDESGAEFC GSRLTERIHG TNSNMNWSHN  180
VLQVDCSGFN ESFCRPIKMN QEDPHQSTEL MQPSAQELMP NNDIASKNLV ELKSLKRKAS  240
DSDIDLNLSL KLSSRVSDEK HGSMVEHEID SNLSLSLCSQ SSSSYNLSSR LRKSSQDHSK  300
EQGERGRTLD LTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1765119458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1765119458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1765119357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1765119357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1765119357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1765119357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1765119458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1765119458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1765119458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1765119458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1765119458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1765119458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang04g08830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017407288.10.0PREDICTED: two-component response regulator ORR22-like
TrEMBLA0A0L9T9A30.0A0A0L9T9A3_PHAAN; Uncharacterized protein
STRINGXP_007140226.11e-144(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-42G2-like family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]