PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang04g05580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 252aa    MW: 28610.3 Da    PI: 7.505
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang04g05580.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74.2e-183688456
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Vang04g05580.1 36 KKRLNLEQVKALEKSFELGNKIEPERKVQLAKALGLQPRQIAIWFQNRRARWK 88
                    4568889*********************************************9 PP

2HD-ZIP_I/II1231.5e-3934123190
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                     ekk+rl+ eqvk+LE+sFe  +k+eperKv+la++Lglqprq+a+WFqnrRAR+ktkqlEk+yeaLk++++a k++n+ L++++++L++e
  Vang04g05580.1  34 EKKKRLNLEQVKALEKSFELGNKIEPERKVQLAKALGLQPRQIAIWFQNRRARWKTKQLEKEYEALKKQFEAAKADNDVLKSQNQKLQAE 123
                     69*************************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.1E-192992IPR009057Homeodomain-like
PROSITE profilePS5007116.4873090IPR001356Homeobox domain
SMARTSM003892.2E-173394IPR001356Homeobox domain
CDDcd000861.64E-153591No hitNo description
PfamPF000462.3E-153688IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.5E-193893IPR009057Homeodomain-like
PRINTSPR000318.2E-66170IPR000047Helix-turn-helix motif
PROSITE patternPS0002706588IPR017970Homeobox, conserved site
PRINTSPR000318.2E-67086IPR000047Helix-turn-helix motif
PfamPF021834.9E-1090123IPR003106Leucine zipper, homeobox-associated
Gene3DG3DSA:1.20.5.1707.4E-494124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MLKRSMSFSG IENKCDEVNG DDELSDDGNF QCGEKKKRLN LEQVKALEKS FELGNKIEPE  60
RKVQLAKALG LQPRQIAIWF QNRRARWKTK QLEKEYEALK KQFEAAKADN DVLKSQNQKL  120
QAEGNMNLIT DQNLGVSVTK LFFLILIQIS VLQAVKSRGW CENGIISLKK ETEGSWSNGS  180
DNSSDIHLEL SRAPIMNNAT SCQAPFPTSI TQILQYSSKP DFHDDDFCNV IHNAAQQTFW  240
PWPGQQSHHF H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18290RRARWKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang04g05580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017417565.11e-160PREDICTED: homeobox-leucine zipper protein HAT7
TrEMBLA0A0L9U2651e-158A0A0L9U265_PHAAN; Uncharacterized protein
STRINGXP_007139587.11e-143(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.15e-55homeobox 3