PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0492s00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 126aa    MW: 13824.5 Da    PI: 6.6681
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0492s00080.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26057.34.6e-182712998
            DUF260 29 kfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98
                      +f+n+ +lFG +n+l+l++ +++++r+ +++s++ eA++  +dP++Ga+g++l+l++q+++++ el+ ++
  Vang0492s00080.1  2 DFENACRLFGLANLLRLMRCAEPSQRQVMANSILTEANMYGNDPIHGALGHVLNLNNQIQSVQRELDFVN 71
                      699**************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.168174IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-15270IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MDFENACRLF GLANLLRLMR CAEPSQRQVM ANSILTEANM YGNDPIHGAL GHVLNLNNQI  60
QSVQRELDFV NTMLAQCSLQ STSHVDDVVA GSSHPGQSST VAPREKEGGA QEKDAEYKRK  120
NKKDH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0492s00080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-141AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017407119.12e-90PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A0S3SAE05e-89A0A0S3SAE0_PHAAN; Uncharacterized protein
STRINGXP_007133438.18e-51(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1630089
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G19820.13e-11LOB domain-containing protein 9