PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g11890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YC
Protein Properties Length: 241aa    MW: 26414 Da    PI: 6.5038
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g11890.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC150.14.4e-478316321101
           NF-YC  21 lPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                     lPlarikki+kadedv+misaeaPv++++ace+fileltlrsw+h+eenkrrtl+k+diaaa+trtdifdflvdivpr++l
  Vang03g11890.1  83 LPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 163
                     9*****************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471136.54E-2972154IPR009072Histone-fold
Gene3DG3DSA:1.10.20.108.8E-3883160IPR009072Histone-fold
PfamPF008081.6E-2183145IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
LGNIRVRSDN VSQNRSHSFC FCTSLSEVLD YKCLGSATSS LGERMDHQGH GQNPSMGVVG  60
SGAQLTYGSN PYQQGQITGP PGLPLARIKK IMKADEDVRM ISAEAPVIFA RACEMFILEL  120
TLRSWNHTEE NKRRTLQKND IAAAITRTDI FDFLVDIVPR EDLKDEVLAS IPRGTMPVGG  180
PADALPYCYM PPQHAPQVGT GGVIMGKPVM DPNMYAQQSH PYMAPQMWPQ PPDHHNQAPD  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_B1e-38831602097NF-YC
4awl_C1e-38831601794NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
4csr_B1e-38831601794NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132138RRTLQKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147065.11e-122hypothetical protein PHAVU_006G093200g, partial
SwissprotQ8L4B23e-68NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLI1NC071e-127I1NC07_SOYBN; Uncharacterized protein
STRINGGLYMA19G42460.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.42e-69nuclear factor Y, subunit C9