PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g10380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 414aa    MW: 45656.6 Da    PI: 4.9082
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g10380.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.85.8e-34201255155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWtpeLHe+Fveav+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Vang03g10380.1 201 KTRMRWTPELHEAFVEAVNQLGGSEKATPKGVLNLMKVDGLTIYHVKSHLQKYRT 255
                     68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.504198258IPR017930Myb domain
SuperFamilySSF466895.73E-18199255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-32199257IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-25201255IPR006447Myb domain, plants
PfamPF002497.6E-10203254IPR001005SANT/Myb domain
PfamPF143795.9E-21288332IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MSSSSRVLPT PLENKYMKPP DSCHLSPASD LAANSVSSNL ITSAGKIISS PSEYPDGTPF  60
PYASQHDRQN EDLPFVSQTL GDNVSSEIHS TTFISHPHES TDITWGPDPF QDILGFPENI  120
SAQHDQVVDN ACYINDENVK RTDFGEWVDQ LMSIDDSLHP NWSQLLGDDN AAEPKPKVPQ  180
LLDIPSGEVN GNSAATTPQT KTRMRWTPEL HEAFVEAVNQ LGGSEKATPK GVLNLMKVDG  240
LTIYHVKSHL QKYRTARYKP EPSEGTSEKK TTPIEEMNSL DLKTSKGITE ALRLQMDLQK  300
RLHEQLEIQR KLQIQIEDQG KRLQMMFEKQ REMGGKKVNG SSGEAAAATA TTATPSDNVH  360
PSSPPVETSN EGHEKMMHEE KNGSTKQKTS EGEEVMNEDE DEIAPATKRV KSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-30201259260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-30201259260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-30201259260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-30201259260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-30201259260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-30201259260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-30201259260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-30201259260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang03g10380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN2015270.0JN201527.1 Glycine max PHR2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017440383.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A0S3S5050.0A0A0S3S505_PHAAN; Uncharacterized protein
STRINGXP_007147208.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.21e-90G2-like family protein