PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g09300.1
Common NameLR48_Vigan09g164600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 164aa    MW: 18572.2 Da    PI: 5.0717
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g09300.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.51.3e-3916114199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaC++lrr+C ++C lapyfp ++ ++fa+vh++FGa+nv+k++++++e +r da++s+vyeA ar+rdPvyG++gvi +lq+ +e+lka+l+
  Vang03g09300.1  16 PCAACRMLRRRCDSKCELAPYFPTDEVENFAVVHRVFGARNVIKMIQTVEEAKRGDAVKSMVYEATARLRDPVYGSAGVIYELQKMIEELKAQLD 110
                     7********************************************************************************************99 PP

          DUF260  96 llke 99 
                     ++++
  Vang03g09300.1 111 SIRT 114
                     8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.93415116IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-3916113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MAFHADEAKT SMQHQPCAAC RMLRRRCDSK CELAPYFPTD EVENFAVVHR VFGARNVIKM  60
IQTVEEAKRG DAVKSMVYEA TARLRDPVYG SAGVIYELQK MIEELKAQLD SIRTRMSEMR  120
EEKEQLLSIG NNYDPMFDSA MTSDPFDFPV EGGWLYSNIS TPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-321611611111LOB family transfactor Ramosa2.1
5ly0_B3e-321611611111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang03g09300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-172AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017434724.11e-121PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-42LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0L9VDK11e-120A0A0L9VDK1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S4S81e-120A0A0S3S4S8_PHAAN; Uncharacterized protein
STRINGXP_007147329.11e-97(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140681921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-45LOB domain-containing protein 1
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]