PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g03760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 668aa    MW: 73009.5 Da    PI: 6.6634
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g03760.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.1e-334296155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt++LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Vang03g03760.1 42 KPRLRWTQDLHERFVDAVTQLGGASKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 96
                    79****************************************************8 PP

2G2-like106.41.6e-33387441155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rlrWt+eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Vang03g03760.1 387 KQRLRWTHELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 441
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.5693999IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-313997IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-234297IPR006447Myb domain, plants
SuperFamilySSF466891.97E-164298IPR009057Homeodomain-like
PfamPF002495.8E-74495IPR001005SANT/Myb domain
PfamPF143796.0E-15137182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PROSITE profilePS5129414.134384444IPR017930Myb domain
SuperFamilySSF466891.08E-17385441IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-32386442IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-25387442IPR006447Myb domain, plants
PfamPF002493.5E-9389440IPR001005SANT/Myb domain
PfamPF143794.7E-23474520IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
MYPRLIHPHD GIVAQDDMQA AASNLSHSHK GDPCLVLTAD PKPRLRWTQD LHERFVDAVT  60
QLGGASKATP KAIMRTMNVK GLTLFHLKSH LQKYRLGKQS GKDVGEGCKD GSYLLESPGT  120
ENTSPKLPTS DTNEGYEIKE ALRAQMEVQS KLHLQVEAEK HLQIRQDAER RYMAMLERAC  180
KMLADQFIGA TVIDTDSQKF QAIGSKTPRG TLVDPLGFYS LPSAEVAGVN VPDEEIAPSL  240
PPQRADCSTE SCLTSHESSG GLTLEGSPGG GKRRMLGMDS MAAPLIWSEA KMRTQAINVA  300
QGSLPQGITS LVGWGARLFI SDILGGFNLY KETVCLSMRL EFFPGNSPEE RNREALVHGQ  360
HIDCGGSAMD PGNGGNNHSN NSNLTSKQRL RWTHELHERF VDAVAQLGGP DRATPKGVLR  420
VMGVQGLTIY HVKSHLQKYR LAKYLPDSSS DEGKKADKKE TGDVLSNLDG SSGMQITEAL  480
KLQMEVQKRL HEQLEVQRQL QLRIEAQGKY LKKIIEEQQR LSGVLSEAPD TEVVAVVPGD  540
VCQEPDNKTD PSTPDPEKAA KDRVPAKSLS MESFSSHHEP LTPDSGCHIG SPADSPKGER  600
STKKQRLNMD GSYSKPDMVL PLQILESSMS QYQHPSTVFL GQEQFDPSLG MATRSGEELD  660
KVGGSNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-2342444158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-2342444158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-2342444158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-2342444158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang03g03760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5007630.0EU500763.1 Phaseolus vulgaris phosphate high response (PHR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023903823.10.0uncharacterized protein LOC112015623
SwissprotQ9SJW01e-114PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A4D6KL560.0A0A4D6KL56_VIGUN; Two-component response regulator ARR-B family
STRINGXP_010059710.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-99G2-like family protein