PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0372s00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 98aa    MW: 10684.6 Da    PI: 4.535
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0372s00130.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26028.44.5e-0929646095
            DUF260 60 slvyeAearardPvyGavgvilklqqqleqlkaela 95
                      sl+++A++r+ +Pv+Gavg+++++++++ q+++e++
  Vang0372s00130.1 29 SLLFKACWRTVNPVNGAVGLLWTGNWHIYQASVEIV 64
                      99*****************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.6E-52963IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MLPSSLPNSL AALTSCPSFP MFQKIKDLSL LFKACWRTVN PVNGAVGLLW TGNWHIYQAS  60
VEIVFCWGML RPMLELMGLA SPIAADEETL EVPCSDI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0372s00130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-114AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027916306.11e-28LOB domain-containing protein 37-like
SwissprotQ9SZE84e-17LBD39_ARATH; LOB domain-containing protein 39
TrEMBLA0A4D6KXR32e-27A0A4D6KXR3_VIGUN; Carbamoyl-phosphate synthase large subunit
STRINGXP_007155842.13e-25(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37540.12e-19LOB domain-containing protein 39