PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0304s00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 355aa    MW: 40276.6 Da    PI: 7.7227
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0304s00140.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.2e-3187140255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtp+LH +Fv+av++LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Vang0304s00140.1  87 PRLRWTPDLHLAFVHAVDRLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 140
                       8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.53383143IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2983141IPR009057Homeodomain-like
SuperFamilySSF466893.23E-1485141IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-2287142IPR006447Myb domain, plants
PfamPF002491.9E-888139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MDERICISEE EKSESSRPSS ARLRRKRSFF DLNEEAVDDG DGSTSDDPIS NNEISSQEGN  60
LSSNNNSSDE GKERGTAVRQ YVRSKMPRLR WTPDLHLAFV HAVDRLGGQE RATPKLVLQL  120
MNVRGLSIAH VKSHLQMYRS KKLDESGQVL SQNRAMQGRH SIFDMYGRLN APRHFVVDNR  180
NYVPSSLLME QSPYQISAHS SRLHPTGFFN SHHMMIRSSS VWDKDLRNYQ YQRSSCSPNF  240
TGHAKFDAEV GDVKNGMPEF LNQVQVRKQG EMKDEYEKKG SMSILEVNLS KDSRKVKKDD  300
AESEEEINTR LSLSLFTSSS SNSSQQAQCS ENHKDDTHVE SFCLQNYAAR SRLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1888142357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1888142357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1888142357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1888142357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0304s00140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017423628.10.0PREDICTED: two-component response regulator ARR18-like
TrEMBLA0A0S3SHM50.0A0A0S3SHM5_PHAAN; Uncharacterized protein
STRINGXP_007149732.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-39G2-like family protein