PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g15370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 283aa    MW: 32221.9 Da    PI: 7.2544
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g15370.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.8e-1886138456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Vang02g15370.1  86 KKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 138
                     556899**********************************************9 PP

2HD-ZIP_I/II128.82.2e-4184176193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekk+rls eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEk+ye+Lk++++a+k++n++L++++++L++el++
  Vang02g15370.1  84 EKKKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKEYEVLKKQFEAVKADNDSLKAQNQKLHAELQT 176
                     69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-1976142IPR009057Homeodomain-like
PROSITE profilePS5007117.15180140IPR001356Homeobox domain
SMARTSM003894.6E-1883144IPR001356Homeobox domain
CDDcd000862.04E-1585141No hitNo description
PfamPF000461.7E-1586138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-1987147IPR009057Homeodomain-like
PRINTSPR000319.8E-6111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000319.8E-6120136IPR000047Helix-turn-helix motif
PfamPF021834.1E-15140180IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MAFPPSHTFM FQTHEDHDHH QLHLRSTSSS LNAFPSFPPH HFQGGGAGAG FMMKRSMSFS  60
GIENKCDEVH GDDELSDDGS QLGEKKKRLS LEQVKALEKS FELGNKLEPE RKMQLAKALG  120
LQPRQIAIWF QNRRARWKTK QLEKEYEVLK KQFEAVKADN DSLKAQNQKL HAELQTLKNR  180
DCCETGTVIS HKKDTEGSWS NGSNNSSEIN LDLSRTPVMN SPVSSQNGKS LLPTSHKPTT  240
MTQLLQSSSR SDLQDESFCN MFHNIDEQQN FWPWTEQQHQ FH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAPTransfer from AT3G01220Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang02g15370.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:12644682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017437748.10.0PREDICTED: homeobox-leucine zipper protein HAT7-like isoform X1
SwissprotQ8LAT01e-82ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLA0A0S3T7R20.0A0A0S3T7R2_PHAAN; Uncharacterized protein
STRINGXP_007151217.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.11e-72homeobox protein 20