PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g12500.1
Common NameLR48_Vigan10g220100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GeBP
Protein Properties Length: 379aa    MW: 42568 Da    PI: 9.448
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g12500.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573105.83.3e-33162257297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     lfqr+wseeDe+ +L+G+++f +ktg++++  +daf++f+kks++++vs++ql eKirr+KkKf+++++k+k+g  p++ ++hd+ ++elskkiW
  Vang02g12500.1 162 LFQRIWSEEDEVGILKGILEFISKTGQEAYRYVDAFHNFIKKSLHVEVSSHQLKEKIRRMKKKFETREAKKKKGIWPRLLRPHDRAVYELSKKIW 256
                     69********************************************************************************************* PP

          DUF573  97 g 97 
                     g
  Vang02g12500.1 257 G 257
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.5E-30163257IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MTKKPKQRPA PVEDPSTASS SESEEDDDRP HSSQQHAAAP QVSSSEEEDD SSEEDEKKLS  60
TLPASANHPS KPHPKSYSSE SEPDTDSEPA RVKPKPKPTD LPQPKVQAQR SSTPVKPGSK  120
RPAHVTEPKR AKKKPAEAPS PSVANDETEE DGKKSGGQTR VLFQRIWSEE DEVGILKGIL  180
EFISKTGQEA YRYVDAFHNF IKKSLHVEVS SHQLKEKIRR MKKKFETREA KKKKGIWPRL  240
LRPHDRAVYE LSKKIWGEWP NGLVEKPKPL AKYVTKTQKK ESKAEDKVPS QPSAPLLALP  300
APESCDVSLL YSSISCFKEL DEDEMKRGLT LIGESKRKEL ERRWKVLQYS EMELLANRSL  360
LIGEQIKLVS EALQSSNN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127134PKRAKKKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang02g12500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017437514.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0L9VNI10.0A0A0L9VNI1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T8S50.0A0A0S3T8S5_PHAAN; Uncharacterized protein
STRINGXP_007151503.11e-148(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.16e-21DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]