PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g11670.1
Common NameLR48_Vigan10g176600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 347aa    MW: 38840.8 Da    PI: 6.3938
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g11670.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.12.6e-3047100154
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                     kprl+Wtp+LHerF+eav+qLGG++kAtPkt+l+lm+++gLtl+h+kSHLQ  R
  Vang02g11670.1  47 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQVQR 100
                     79*************************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.83744104IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2745100IPR009057Homeodomain-like
SuperFamilySSF466893.4E-1446101IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-2147101IPR006447Myb domain, plants
PfamPF002498.1E-94998IPR001005SANT/Myb domain
PfamPF143797.2E-1291123IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MYHQQQQQIA ARNLHALRMH SHTERHMMMQ GGNGACDSGL VLSTDAKPRL KWTPDLHERF  60
IEAVNQLGGA DKATPKTVLK LMGIPGLTLY HLKSHLQVQR HLQLRIEAQG KYLQAVLEKA  120
QETLGRQNLG AEGVEAAKVQ LSELASRVSS QSLDTKFSEL KELQVLWPQQ TQEGQATECS  180
MGSFLTYSED SQRDRETHNM SLNLIAFNGP PFSVSKDCVE ESMHLKPDLT LSEDVKQNMM  240
FLSSSSDGKV VKGDFLQEGP SSLLSMNVGV LEEEKFGRTT LSKEEGWKVR NSTESGRMAV  300
KLNHEKISPD YRLPNFEVKL DLNSHDDNDA SSHCQQFDLN GFSWNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1946105160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1946105160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1946105160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1946105160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1946105160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1946105160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1946105160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1946105160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang02g11670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017439033.10.0PREDICTED: myb-related protein 2-like isoform X2
TrEMBLA0A0L9VMA20.0A0A0L9VMA2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T9V20.0A0A0S3T9V2_PHAAN; Uncharacterized protein
STRINGXP_007151824.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.15e-82G2-like family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]