PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g03980.1
Common NameLR48_Vigan10g084800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 685aa    MW: 75324.6 Da    PI: 5.7634
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g03980.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.1e-0955862656
                    -HHHHHHH.HHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox 26 saeereeL.AkklgLterqVkvWFqNrRakek 56
                    + +++++L Ak+lgL+ +qVk+WFqNrR+++k
  Vang02g03980.1 55 TPQQIQDLeAKRLGLENKQVKFWFQNRRTQMK 86
                    567888887999*****************999 PP

2START31.73.5e-11243336283
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     +a  a++elvk+a  + p+W kss    e +n de+ + f++  v      + +ea ra+gvv + +  lve+++d+  +W+e++     +a tl
  Vang02g03980.1 243 IAINAMDELVKMARQDNPLWIKSSdgrnEVLNCDEYARMFPTF-VgtkpagYVIEATRATGVVLASSLGLVETFMDVD-RWQEMFSsmvaSACTL 335
                     57789*******************999999999****999774.25999*****************************.******9555555555 PP

                     E CS
           START  83 e 83 
                     +
  Vang02g03980.1 336 D 336
                     5 PP

3START85.61.1e-27339430115206
                     EEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 115 irqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++ + +g+wv+vdvS+d  ++ ++s++++ +++lpSg++i++++ng sk+twveh  ++++++h+l r+lv+sg+ +ga++w a l rqce+
  Vang02g03980.1 339 CKHHAEGVWVVVDVSIDIMRNASNSHPSMSCRRLPSGCVIQDMPNGLSKITWVEHSQYDESVIHQLCRPLVSSGIGFGAQRWIASLLRQCEC 430
                     8999**************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.63E-103088IPR009057Homeodomain-like
SMARTSM003890.0084792IPR001356Homeobox domain
CDDcd000868.28E-84888No hitNo description
PfamPF000461.3E-65586IPR001356Homeobox domain
PROSITE profilePS5007110.7546488IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-76495IPR009057Homeodomain-like
PROSITE profilePS5084826.343233433IPR002913START domain
SuperFamilySSF559611.22E-19236430No hitNo description
CDDcd088758.77E-85237429No hitNo description
SMARTSM002346.1E-8242430IPR002913START domain
PfamPF018522.3E-5243328IPR002913START domain
PfamPF018522.5E-22339430IPR002913START domain
SuperFamilySSF559614.81E-13452648No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MMGESFDTSN LLGRIRDDDY ESRSESDNFD GGSGDEQDVG DDQPQRKKKK YHRHTPQQIQ  60
DLEAKRLGLE NKQVKFWFQN RRTQMKTQLE RHENMVLKQE NDKLRAENGV MKEALANPIC  120
NNCGGPAIPG QISLEEHQTR IENARLKDEL NRICTLANKF LGRSLSSLAS PMSLTPPNSG  180
LDLAIGRNGI GGSSNFGMPV PIGFDLGDGA LGSSPAMASM GARAPLGMMG NEIHLDRSML  240
IDIAINAMDE LVKMARQDNP LWIKSSDGRN EVLNCDEYAR MFPTFVGTKP AGYVIEATRA  300
TGVVLASSLG LVETFMDVDR WQEMFSSMVA SACTLDVFCK HHAEGVWVVV DVSIDIMRNA  360
SNSHPSMSCR RLPSGCVIQD MPNGLSKITW VEHSQYDESV IHQLCRPLVS SGIGFGAQRW  420
IASLLRQCEC LAILMTPPGP SDDPTVLSQS NRRSVLKLAQ RMNEYFCSGI CASSARKWDV  480
LHIGSLADDM KIMARKIVDD PNEVPGYVLS ASTCVWLPVP RQRVFDFLRN EQLRGEWDML  540
SKGGPMKEML HVPKGQDHGN CVSILHYANN EGNVLYLQES WTDASGSMVV YSPINMQSLN  600
MMMMNSGDSS FVSLRPSGFA ILPDGHSNNS DNNDGGGGSC LLTVGLQMLQ NDNPSAKFTL  660
ESVQTINSLL SCTIQKVKEA LGVS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang02g03980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017438850.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
RefseqXP_017438851.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0L9VIU40.0A0A0L9VIU4_PHAAN; Uncharacterized protein
STRINGXP_007152327.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]