PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g02180.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CPP
Protein Properties Length: 681aa    MW: 73904.9 Da    PI: 8.0287
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g02180.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.61.4e-14177216242
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C+N+ e+
  Vang02g02180.2 177 KQKQCNCKHSKCLKLYCECFASGIYCDG-CNCVNCFNNVEN 216
                     89**************************.********9875 PP

2TCR50.73.7e-16261300140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Vang02g02180.2 261 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 300
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-17176216IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.003177301IPR005172CRC domain
PfamPF036383.5E-11178213IPR005172CRC domain
SMARTSM011148.4E-20261302IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-12264299IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
LQLPYLSSAP FPRALRLDPR ASQFRYTRSN QSRATQSAHV FEFELRFEAI EALFRFIAVI  60
LGLFRRNSGI AVRVFGFFFC VASRAMGEEE GGDIAPKNAL SSEVVPPAVT STAALEVPAK  120
KLARQLDFTG APDHPQQQPV AALPLPPQAP HSRIGKPESP KSRSRSNFEM KDATPKKQKQ  180
CNCKHSKCLK LYCECFASGI YCDGCNCVNC FNNVENEAAR REAVEATLER NPNAFRPKIA  240
SSPHGTRDSR EEAGEVLILG KHNKGCHCKK SGCLKKYCEC FQANILCSEN CKCMDCKNFE  300
GSEERQALFH GDQNNMAYIQ QAANAAITGA IGSSGYSSPP VSKKRKGQEL FFWPTAKDPS  360
ISKLGQQVNH VRGPAPSSSL SPVSGARVGT ATLGPSKFMY RSLLADIIQP QHLKELCSVL  420
VLVSGQAAMT LSDQKILMEK HAEDQTETSL ASSSQEQLPP SQKEGHVEKT VADDCSSANQ  480
TDKISPDDSS SDGADVPKGR PMSPGTLALM CDEQDTMFMT AASPIGPMAH ACNTSSQFPY  540
GQGMTEVYAE QERIVLTKFR DFLNRVITMG EINGKLILSP FQISDATSLT LHIGGLTLVL  600
NTLLYETKCS SLARNELENQ KDPIINGIGN ANSVIVRQHG TSSNGVTKPS VSPLATTSTR  660
MIPGNISENG ESKVKIEKDI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-321693102132Protein lin-54 homolog
5fd3_B6e-321693102132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang02g02180.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017440570.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A4D6LUG10.0A0A4D6LUG1_VIGUN; Uncharacterized protein
STRINGXP_007152845.10.0(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-167Tesmin/TSO1-like CXC domain-containing protein