PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g01050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 382aa    MW: 42178 Da    PI: 6.3915
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g01050.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like51.42.4e-162372672555
         G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Vang02g01050.1 237 SRATPKSVLELMDVKDLTLAHVKSHLQMYRT 267
                     79****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-14237268IPR009057Homeodomain-like
SuperFamilySSF466891.11E-5237268IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-11237267IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MPQNSIFRDQ SSNQIPDLSL HISLPNSAPS SICTGGDSPF DTWPQQADED DYAEGFKSHS  60
DGSIKGCSPY HTDTQLSLAN STTAFTATPS EADSTWRKRN FVRLSHHHGV SDGQIRLING  120
IPLYSNLSSL DNTSTAPSIE RSPTNKFSFP SLYSLPHPPY SANSAPNYSY NGAVGGVAAE  180
PISRFHDITM ENTPRPQQFQ YFDYPQQQQQ FGNSTNFGAS EFSNGFVRSR MLPRQQSRAT  240
PKSVLELMDV KDLTLAHVKS HLQMYRTVKN TDKPAPSSDG DEDFMSITVP NNQNKNFLPN  300
QRGAPNASMD HDMGHTSRNL WANSSTSRGA RIEASAHDLE EIIASQHSGK FSEGNNNYTQ  360
TRSFKDQNPS LEFTLGRSTQ E*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang02g01050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017438934.10.0PREDICTED: probable transcription factor KAN4 isoform X1
TrEMBLA0A0S3TBV50.0A0A0S3TBV5_PHAAN; Uncharacterized protein
STRINGGLYMA07G12070.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-22G2-like family protein