PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0273s00020.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 882aa    MW: 97000.4 Da    PI: 6.1984
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0273s00020.4genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.2e-1694138147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Vang0273s00020.4  94 RERWTEEEHNRFLEALKLHGRA-WQRIEEHIG-TKTAVQIRSHAQKF 138
                       78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.04E-1688142IPR009057Homeodomain-like
PROSITE profilePS5129419.91389143IPR017930Myb domain
TIGRFAMsTIGR015571.4E-1592141IPR006447Myb domain, plants
SMARTSM007171.3E-1293141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-894134IPR009057Homeodomain-like
PfamPF002492.2E-1394137IPR001005SANT/Myb domain
CDDcd001671.82E-996139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 882 aa     Download sequence    Send to blast
LNFDGFELLC DYIFSATKQE ESKFAVISKV FVKVKIEIVV IDDVVISFCF YTNCSFPLFA  60
FESGSCSRPV MDAYSSGEEV VVKTRKPYTI TKQRERWTEE EHNRFLEALK LHGRAWQRIE  120
EHIGTKTAVQ IRSHAQKFFT KIADSRAKWY RGLDKPYLGK WLSGADGGGF LFQEHILEEI  180
HGLIDHHDKS AVPTLGTGKF RDTLEKEALV KGVPIGQALD IDIPPPRPKR KPSNPYPRKT  240
RIGTATLHSG AKDGKINLVE FSHDNQALDL EKEPVPEIYD LDEGPTTVKE NKDENCSKVF  300
TDIQEVPCSS LSSANRSSIS MSVPLGNSCV FKETTTSVKE VITPDDKTES FLTVELENGN  360
LEINGGKQAN GTSKNSTLEN SDALLMKLVQ NEKTDGLDSA LTIEGMQGNN QNYPRHVTVH  420
VVDGNLGTCT QNPSQDMLFR DCMFQPIGGA NGQPNLFTNS APSNTRESQN NTARSSAHQS  480
FLPYPPFTQH NQDDYQSFLH MSSTFSNLIV STLLQNPAAH AAASFAATFW PYANPETSAD  540
SPRCSQGGFT SRHIGSPPSV VAIAAATVAA ATAWWAAHGL LPLCAPLHTA FACPPASVTA  600
VPSMNTSETP SLKAEQEKST LQNPPLHDQM MHPEYSEAPQ AQHSASKSLA VISSDSESGD  660
VKLNTSPKAT DHETNEIISE HLDSNKTKGR KQVDRSSCGS NTASSSDVET DALGKDEKGK  720
EEPETPDANH LAIEFSNRRR SICNLTDSWK EVSEEGKLAF QALFSREVLP QSFSPPHALT  780
NKDQMGITND NQQTIDDRNE DLESKKCSSI YKPMQKNPPF VENNVGLLTL GLGQGKLKTR  840
RTGFKPYKRC SMEAKENRVG ASNQGEEKCC KRIRLEGDTS T*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0273s00020.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017442031.10.0PREDICTED: protein LHY-like
RefseqXP_017442032.10.0PREDICTED: protein LHY-like
RefseqXP_017442033.10.0PREDICTED: protein LHY-like
RefseqXP_017442034.10.0PREDICTED: protein LHY-like
RefseqXP_017442035.10.0PREDICTED: protein LHY-like
RefseqXP_017442036.10.0PREDICTED: protein LHY-like
RefseqXP_017442037.10.0PREDICTED: protein LHY-like
RefseqXP_017442038.10.0PREDICTED: protein LHY-like
RefseqXP_017442039.10.0PREDICTED: protein LHY-like
TrEMBLA0A0L9VQJ20.0A0A0L9VQJ2_PHAAN; Uncharacterized protein
STRINGGLYMA07G05410.60.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-101MYB_related family protein