PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g18280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRF
Protein Properties Length: 518aa    MW: 56713 Da    PI: 7.3433
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g18280.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC44.23.4e-14209234227
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkkl 27 
                     +epgrCrRtDGKkWRCsr+++ ++k+
  Vang01g18280.1 209 PEPGRCRRTDGKKWRCSRDAVVDQKM 234
                     89*********************996 PP

2QLQ62.61e-21152188137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FT++Q+++L++Q+l+yKy+ an+PvP +Ll +i+k
  Vang01g18280.1 152 GPFTPSQWMELEHQALIYKYITANVPVPTHLLIPIRK 188
                     59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.0E-12152188IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.5E-16153187IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.473153188IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166714.154208252IPR014977WRC domain
PfamPF088796.1E-11209234IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
LMDLGVVGLE GLVGSDSSCA FGSSLASDPE TKHKWYGSGV LKQERSGTAS EDEWRTSKVP  60
KTDDNMSAAS KAMLFHQRNS LLRSNVTLFS EGHNQPQMLS FSSPKSEPLM VDKASLNATL  120
PFSYHQLSSY SRNTGYSSGS ISMHGALAGV RGPFTPSQWM ELEHQALIYK YITANVPVPT  180
HLLIPIRKAL DSAAFCNFST GLLRPNTYPE PGRCRRTDGK KWRCSRDAVV DQKMFMSSKE  240
NSNNASERMQ DGPALPMVPP TLELKPKDPF MIHKHQLPYD ESSSRNNNEF GLVTSDSLLN  300
PSQKRSFGSS SSQKDDSESQ QQHSLRHFID DSPKPQSHHH HHHHRSSVWP ELDNMQSDRT  360
QLSISIPISS SDFMSFTTSS PSNEKLTLSP LRLSREIDPI QMGLGVGSGA PNESNTRQAN  420
WIPITWESSM GGPLGEVLNL SSTNNNSNGS DHCGKNTSAL NLMKDGWDNS PPLGSSPNGV  480
LQKTAFGSLS NSSAGSSPRA ENNNIKEGLY YSAYFSI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628642.10.0PREDICTED: growth-regulating factor 6-like isoform X2
TrEMBLA0A0R0EEA80.0A0A0R0EEA8_SOYBN; Uncharacterized protein
STRINGGLYMA17G35090.21e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.14e-60growth-regulating factor 2