PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g18210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 285aa    MW: 32436.7 Da    PI: 6.1123
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g18210.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.1e-20127181256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq  +Lee F+++++++ ++++eLA+kl+L +rqV vWFqNrRa+ k
  Vang01g18210.1 127 RKKLRLTKEQSAILEETFREHSTLNPKQKQELAMKLNLRTRQVEVWFQNRRARTK 181
                     78889************************************************98 PP

2HD-ZIP_I/II122.32.3e-39127215189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +kk+rl+keq+++LEe+F+e+++L+p++K+ela +L+l++rqv+vWFqnrRARtk+kq+E+d++ Lk+++d+l+een+rL+keveeL++
  Vang01g18210.1 127 RKKLRLTKEQSAILEETFREHSTLNPKQKQELAMKLNLRTRQVEVWFQNRRARTKLKQTESDCDLLKKCCDSLTEENKRLQKEVEELKS 215
                     69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.459123183IPR001356Homeobox domain
SuperFamilySSF466891.21E-18124191IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-18125187IPR009057Homeodomain-like
SMARTSM003892.3E-16125187IPR001356Homeobox domain
CDDcd000862.13E-16126184No hitNo description
PfamPF000461.9E-17127181IPR001356Homeobox domain
PROSITE patternPS000270158181IPR017970Homeobox, conserved site
PfamPF021832.8E-10183216IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.0E-18183227IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MYSVHSYSTS TTSDKILSHY SPYGYDDSKA NKRVENPSDC NKTYPSLTLG PPEDDDHDEV  60
KNDRPSSKTE SYEYFRAQVS SPSVVSSFSN SSSIKRERDQ ATGEEFDVDL ENVQTRVADA  120
DEDGNPRKKL RLTKEQSAIL EETFREHSTL NPKQKQELAM KLNLRTRQVE VWFQNRRART  180
KLKQTESDCD LLKKCCDSLT EENKRLQKEV EELKSMQAIS VPLYMQIPAA TLSLCPSCER  240
ICDSKSDDEN TNNNTSSLLF PSKTHHNHFY KSNYPFSHSS SAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175183RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang01g18210.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017429481.10.0PREDICTED: homeobox-leucine zipper protein HAT9-like isoform X1
SwissprotA2XE761e-61HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-61HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A0L9V2D00.0A0A0L9V2D0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RPN80.0A0A0S3RPN8_PHAAN; Uncharacterized protein
STRINGGLYMA14G10370.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-59homeobox from Arabidopsis thaliana