PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g08540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 137aa    MW: 15185.7 Da    PI: 8.0477
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g08540.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601361.4e-42201191100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+C++dC+lapyfp+++  kfa+vhk+FG sn++k+lk++p e+r da++slvyeA+ar+r+PvyG+vg+i+kl+ q+++l+ +la
  Vang01g08540.1  20 PCASCKLLRRRCSPDCILAPYFPSNDLCKFAMVHKVFGCSNITKILKNVPVEQRGDAVRSLVYEANARIRNPVYGCVGIISKLETQVSELQMQLA 114
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     +++ee
  Vang01g08540.1 115 VVEEE 119
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.23819120IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4220117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MLHAGQHRFL DFEMGGTSSP CASCKLLRRR CSPDCILAPY FPSNDLCKFA MVHKVFGCSN  60
ITKILKNVPV EQRGDAVRSL VYEANARIRN PVYGCVGIIS KLETQVSELQ MQLAVVEEEI  120
LSIKMQQEFI FTNGGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-116AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014489817.14e-84PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW33e-56LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0L9UWX92e-87A0A0L9UWX9_PHAAN; Uncharacterized protein
STRINGGLYMA18G02780.11e-56(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-57LBD family protein