PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g07460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 262aa    MW: 28991.1 Da    PI: 7.1625
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g07460.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.32e-411052041100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kf +vhk+FGasnv+k+l ++pe +r da++slvyeA+ r+rdPvyG++g i++lqqq+++l+ael+
  Vang01g07460.1 105 PCAACKLLRRRCAEECPFSPYFSPHEPQKFVAVHKVFGASNVSKMLLEVPEGQRADAANSLVYEANLRLRDPVYGCMGAISALQQQVQSLQAELN 199
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Vang01g07460.1 200 AIRAE 204
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.35104205IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-41105202IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
LPFLSPSVSV YDTKSFSLPT LHSVQENQKG MFGHQDIEHD ALKSPKIQTI FSLQIDGFNM  60
QFLYFPKDRL EEITKVRAEV EASSQMGRKH FYGPTPGITL NTVTPCAACK LLRRRCAEEC  120
PFSPYFSPHE PQKFVAVHKV FGASNVSKML LEVPEGQRAD AANSLVYEAN LRLRDPVYGC  180
MGAISALQQQ VQSLQAELNA IRAEILKYKY REAASLISSN HAALVSSADA ISAAIPTNSQ  240
PQGPFLYYSF DVGIIMFFST E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-43952195125LOB family transfactor Ramosa2.1
5ly0_B2e-43952195125LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang01g07460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014504141.11e-127LOB domain-containing protein 13 isoform X1
RefseqXP_017429809.11e-127PREDICTED: LOB domain-containing protein 13 isoform X1
SwissprotQ9AT612e-72LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0S3RLB51e-132A0A0S3RLB5_PHAAN; Uncharacterized protein
STRINGXP_007142059.11e-123(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.19e-68LOB domain-containing protein 15
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]