PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g06430.1
Common NameLR48_Vigan07g057300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 155aa    MW: 17006.5 Da    PI: 6.4871
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g06430.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.41.4e-4461051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+C+kdC++apyfp+e+p+kfa+vhk+FGasnv+k+l++lp ++r+da+sslvyeA ar+rdPvyG+vg i+ lq+q++ l+ +la
  Vang01g06430.1   6 PCASCKLLRRRCTKDCIFAPYFPSEEPQKFAIVHKVFGASNVSKMLQELPVQQRTDAVSSLVYEASARVRDPVYGCVGAISYLQNQVADLQMQLA 100
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Vang01g06430.1 101 VAQAE 105
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8615106IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCTKD CIFAPYFPSE EPQKFAIVHK VFGASNVSKM LQELPVQQRT  60
DAVSSLVYEA SARVRDPVYG CVGAISYLQN QVADLQMQLA VAQAEILCLQ MENESLIPIS  120
ETDLHQKSYL LQNNFSQLLD FNTSNSKDKV GGGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-160AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502984.11e-103PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-70LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0S3RKF91e-105A0A0S3RKF9_PHAAN; Uncharacterized protein
TrEMBLA0A0L9UWF21e-105A0A0L9UWF2_PHAAN; Uncharacterized protein
STRINGGLYMA14G06140.18e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-71LBD family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]