PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g02790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 108aa    MW: 12294.2 Da    PI: 6.2224
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g02790.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26029.61.9e-09125657101
          DUF260  57 amsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                      m +++   + r++dPvyG+vg+i+kl +q+++++ ela++++++
  Vang01g02790.1  12 SMVAVMLGKCFRIQDPVYGCVGIISKLYEQIHNTEIELAQIQTQI 56 
                     6788888899*****************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.4E-61253IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MILKDLLLFT KSMVAVMLGK CFRIQDPVYG CVGIISKLYE QIHNTEIELA QIQTQITCHK  60
LQLLHPNNAE TNFNLLPTAE AQSNFQIPPE SNNPPQFQWP NQVPWFN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang01g02790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-142AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017428476.11e-56PREDICTED: LOB domain-containing protein 24-like
TrEMBLA0A0L9UVH42e-55A0A0L9UVH4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RJM42e-55A0A0S3RJM4_PHAAN; Uncharacterized protein
STRINGXP_007142295.16e-38(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00210.18e-10LOB domain-containing protein 31