PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0184s00120.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 407aa    MW: 44867.8 Da    PI: 6.5109
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0184s00120.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like47.44.3e-151952292156
           G2-like  21 LGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       L G +kA+P++ile+m++++Lt+++++SHLQkYR++
  Vang0184s00120.2 195 L-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 229
                       6.9*******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.34E-7194232IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-15194229IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.6E-13194232IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
LLYISGVCFA FVVIYSFIPR LKSRLIFMLA VSPLRSTRDE EQGEMESFSI GTDDFADLSE  60
GNLLESINFD DLFMGINDDE DVLPDLEMDP EMLAEFSLSE ESEIVSSVSV VNNKSDDRNE  120
NNIVTTEKQD EVIAANFCSD SGSNSGSSRG EEIASKSEES IHSVVVNPSP KESEKGRKSS  180
THSRNNPQGK RKVKLGVDKA VPSRILEIMG IDCLTRHNIA SHLQKYRSHR KHLLAREAEA  240
ARLSQRKQFM GAASVGRGGG GSKRDVNPWL APTMGFPHMT PMHHFRPFHV WGHHTMDQSF  300
MHMWPKHLPY SPSPPAWPPR TAPSPPPPDP LYWHQHQRAP NAPTPGTPCF PPPLTSTSKE  360
SIDAAISDVL SKPWLPLPLG LKGPALDGVM GELQRQGIPK IPPSCA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0184s00120.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017423186.10.0PREDICTED: transcription activator GLK1
TrEMBLA0A0L9UM080.0A0A0L9UM08_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SHP80.0A0A0S3SHP8_PHAAN; Uncharacterized protein
STRINGXP_007149809.10.0(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.17e-37GOLDEN2-like 2