PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0162s00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 688aa    MW: 75017.8 Da    PI: 6.9806
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0162s00010.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.28.9e-164441656
                      HHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox 16 eelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      ++lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Vang0162s00010.1  4 KKLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 44
                      589***********************************999 PP

2START206.51e-641964181206
                       HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       ela++a++elvk+a+ +ep+Wv+ +    e+ n +e+ ++f++  +     + +ea+r+ g+v+ ++  lve+l+d + +W e+++    + +
  Vang0162s00010.1 196 ELALAAMDELVKMAQTGEPLWVRNVeggrEIMNHEEYARTFTPCIGlrpngFVSEASRENGMVIINSLALVETLMDAN-RWAEMFPciiaRTS 287
                       5899*************************************99998********************************.************** PP

                       EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
             START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                       t+evis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+ + +  p  s +v +++lpSg+++++++ng+skvtw
  Vang0162s00010.1 288 TTEVISNGingsrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIRESSGAP--STFVNCRRLPSGCVVQDMPNGYSKVTW 378
                       **************************************************************99..5************************** PP

                       EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       veh++++++++h+++r+ ++sg+ +ga++wvatlqrqce+
  Vang0162s00010.1 379 VEHAEYDESQIHQVYRPSLNSGMGFGAQRWVATLQRQCEC 418
                       **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.236146IPR001356Homeobox domain
SMARTSM003891.0E-4150IPR001356Homeobox domain
PfamPF000463.1E-13444IPR001356Homeobox domain
CDDcd000868.66E-13446No hitNo description
SuperFamilySSF466896.84E-13450IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-14553IPR009057Homeodomain-like
PROSITE patternPS0002702144IPR017970Homeobox, conserved site
PROSITE profilePS5084844.034187421IPR002913START domain
SuperFamilySSF559613.92E-34188418No hitNo description
CDDcd088752.95E-122191417No hitNo description
PfamPF018522.8E-56196418IPR002913START domain
SMARTSM002347.4E-48196418IPR002913START domain
SuperFamilySSF559612.35E-24445680No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MLKKKLFKEC PHPDEKQRLE LSKRLCLETR QVKFWFQNRR TQMKTQLERH ENTLLRQEND  60
KLRAENMSIR DAMRNPMCSN CGGPAIIGEI SLEEQHLRIE NARLKDELDR VCALTGKFLG  120
RPVSSLPNSS LELGVGGNGF GGMSIGTTLP LGQDFGMGMS MSVSNNPLAM VSPTSTRPTS  180
VVGGFDRSME RSMFLELALA AMDELVKMAQ TGEPLWVRNV EGGREIMNHE EYARTFTPCI  240
GLRPNGFVSE ASRENGMVII NSLALVETLM DANRWAEMFP CIIARTSTTE VISNGINGSR  300
NGALQLMHAE LQVLSPLVPV REVNFLRFCK QHAEGVWAVV DVSIRESSGA PSTFVNCRRL  360
PSGCVVQDMP NGYSKVTWVE HAEYDESQIH QVYRPSLNSG MGFGAQRWVA TLQRQCECLA  420
ILMSSAAPSR DHSAITAGGR RSMVKLAQRM TNNFCAGVCA STVHKWNKLN PGNVDEDVRV  480
MTRKSVDDPG EPPGIVLSAA TSVWLPVSPQ RLFDFLRDER LRSEWDILSN GGPMQEMAHI  540
AKGQDHGNCV SLLRASAINS SQSSMLILQE TCIDEAGSLV VYAPVDIPAM HVVMNGGDSA  600
YVALLPSGFA IVPDGPGSRG SQNGPTAATN GGDNGVARVS GSLLTVAFQI LVNSLPTAKL  660
TVESVETVNN LISCTVQKIK AALHCES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0162s00010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017442222.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
RefseqXP_017442223.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
RefseqXP_017442224.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
RefseqXP_017442225.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0S3SYC60.0A0A0S3SYC6_PHAAN; Uncharacterized protein
STRINGXP_007134961.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]