PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0084s00290.1
Common NameLR48_Vigan04g085200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRF
Protein Properties Length: 542aa    MW: 58371.3 Da    PI: 8.743
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0084s00290.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC70.42.2e-22189228544
               WRC   5 grCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                       +rCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Vang0084s00290.1 189 RRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVE 228
                       8************************************998 PP

2QLQ53.38.5e-19137169234
               QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                       +FT aQ+ +L++Q+++yKy++a++PvP++Ll +
  Vang0084s00290.1 137 PFTSAQWRELERQAMIYKYMMASVPVPHDLLIP 169
                       8*****************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.0E-10136172IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.36137172IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.8E-13137169IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.146185229IPR014977WRC domain
PfamPF088795.5E-18189228IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MGEFGVPHMR KRSSSDNSGG SFVGLDVRVQ SPEALFHNKM TMMAHHNHHH RPLSSPFDND  60
SCAGDGDGPT AYMSFTNHIN LVSGASVLAP AIDGGCGAPA PVRTLQPFDI SPYTSPTTTS  120
STFKLSAGGM AASFGFPFTS AQWRELERQA MIYKYMMASV PVPHDLLIPT SLTPSSRSAC  180
SMNDPLLSRR CRRTDGKKWR CSRDVAPNHK YCERHMHRGR PRSRKPVEVN TKTATPTSIN  240
NNTHQIKRPR HECNPFPSIP DVTVAIPNPT SRKHGPSPHF LGSSTTLPGL DWMLNGDPIS  300
LGASDSEWQS LMHHKVGLSS ESSCNNPQPQ YLNSFTLYNT GLDQQNRRHP LFLNPLVVPM  360
ENLQPEKPRG FIDAWSNTET GENNAPTNSK NSAASIGKLT LSSLDLSMGG GAVNEDVGNV  420
NIGLGLMESI ANTHTDTKIS LSNWVNPAPW VGSTLGGPLA EVLRSSTVTA TTNERTSNTP  480
SPATTHVESN SPLGTMVSSP SGVLQKTLVS LSDSSSNSSP RVASSRANSE MALLRFQGNV  540
N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517093.10.0PREDICTED: growth-regulating factor 2 isoform X1
TrEMBLA0A0L9UDP80.0A0A0L9UDP8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3REI00.0A0A0S3REI0_PHAAN; Uncharacterized protein
STRINGGLYMA04G40880.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.15e-37growth-regulating factor 7
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]