PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0076s00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 351aa    MW: 38182.1 Da    PI: 6.4516
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0076s00140.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.41.3e-27166220156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  Vang0076s00140.1 166 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGINCLTRHNIASHLQKYRSH 220
                       5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.77163222IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-26164223IPR009057Homeodomain-like
SuperFamilySSF466895.38E-18164223IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-26166220IPR006447Myb domain, plants
PfamPF002499.8E-8169218IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
LELMLAVAPL RSIKDEKNQR EMEGFSMAAK SASDDDDFRE LSEGNLLESI NFDDLFVGID  60
VGGDVLPDLE MFGEFSVSAG EESSEMNSSA ENSKEENDRN CVLTVSKKEV EEDKSSCAAS  120
GQEIVSKNGE SVVVNPAPKE GGKGRKSSSA QLKNNSNSNH PQGKRKVKVD WTPELHRRFV  180
QAVEQLGVDK AVPSRILEIM GINCLTRHNI ASHLQKYRSH RKHLLAREAE AASWSQRRHI  240
YGVGKREAPN ALIPGTVGFP QPLTQTGFGT HHVPGIPPHA MYKADHSIGI HGPRPLLDFH  300
PSKECIDAAI GDVLSKPWLP LPLGLKAPAI DSVMSELQRQ GIPNIPPSSA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-15163218257ARR10-B
5lxu_A8e-15171222657Transcription factor LUX
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0076s00140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017433609.10.0PREDICTED: transcription activator GLK1-like isoform X2
TrEMBLA0A0L9V6871e-176A0A0L9V687_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SBB91e-176A0A0S3SBB9_PHAAN; Uncharacterized protein
STRINGXP_007132777.11e-147(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.13e-56GBF's pro-rich region-interacting factor 1