PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0071ss00650.1
Common NameLR48_Vigan11g009500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRAS
Protein Properties Length: 540aa    MW: 59530.6 Da    PI: 5.7553
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0071ss00650.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS248.62.5e-761535272374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++lL  cA a++ g+l+++q+lL  l+elasp+gd+++Rlaa+ ++AL ++l++s  +++    + +++  +     + l  f+evsP++ f
  Vang0071ss00650.1 153 EQLLNPCAAAITGGNLTRVQHLLYVLHELASPTGDANHRLAAHGLKALTHHLSSSLVSTSTGYMTFAST--EPRFFQKTLLKFYEVSPWFSF 242
                        689***************************************************666666555555554..23333334444********** PP

               GRAS  94 shltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg......skeeleetgerLakfAeelgv 174
                         + +aN  Il+ + ++    +++Hi+D+++s+G+QWp++l+aL+ Rp ++pp +R+T+v +++++            +  +rL  fA+ ++v
  Vang0071ss00650.1 243 PNNIANASILQVLGEDndnsRTLHILDIGASHGMQWPTFLEALSRRPgGPPPLVRLTVVTASSTEidtpfsIGPPGDNFSSRLLGFAQLMNV 334
                        ***********997766666899************************55566*********8888998888788899*************** PP

               GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerflealey 263
                        +++++ l    l++l+ ++ +++p+E  +V+ +++lh+l ++s++ +s   e+Lk++++++Pk v+++++++++   + ++F+ +f++ +ey
  Vang0071ss00650.1 335 NLQIKRLDNCPLQTLSAQSVDTSPDEIFVVCAQFRLHQLSHNSTDEKS---EFLKVLRNMEPKGVILSDNNMECccsGCGDFAMGFSRRVEY 423
                        ******8777*****************************977777777...********************887644566************ PP

               GRAS 264 ysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrvee 353
                         ++++ds+ +a  +r+s+er+++E      e+ ++++++ ++    +e +ekW er++eaGF    l+e+a +  ++llrk++ +++++ve+
  Vang0071ss00650.1 424 LWKFLDSTsSAFKGRDSDERRVMEG-----EAAKALTNQREM----NEGKEKWCERMKEAGFVGEVLGEDAIDGGRALLRKYDtNWEMKVED 506
                        ********44444555566666555.....577777777666....99***********************************9999***** PP

               GRAS 354 esgslvlgWkdrpLvsvSaWr 374
                        ++ s+ l Wk++p+ +++ W+
  Vang0071ss00650.1 507 DNRSVGLWWKGQPVSFCTLWK 527
                        ********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.875126506IPR005202Transcription factor GRAS
PfamPF035148.6E-74153527IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MIMEPNPTSD HSLDWFEGSV SFFPLPPFLD DPYNCSDIQL WDQDISSHYQ TDANTSSPNA  60
TNIATTTTPP EPCASNNLPL SDLPKKRSAT DDSSLGQPQN HKHKKIKSKP LNNEADSGDA  120
EGTTTVRKPG GNKKGAAKGV ANNCNNKEGR WAEQLLNPCA AAITGGNLTR VQHLLYVLHE  180
LASPTGDANH RLAAHGLKAL THHLSSSLVS TSTGYMTFAS TEPRFFQKTL LKFYEVSPWF  240
SFPNNIANAS ILQVLGEDND NSRTLHILDI GASHGMQWPT FLEALSRRPG GPPPLVRLTV  300
VTASSTEIDT PFSIGPPGDN FSSRLLGFAQ LMNVNLQIKR LDNCPLQTLS AQSVDTSPDE  360
IFVVCAQFRL HQLSHNSTDE KSEFLKVLRN MEPKGVILSD NNMECCCSGC GDFAMGFSRR  420
VEYLWKFLDS TSSAFKGRDS DERRVMEGEA AKALTNQREM NEGKEKWCER MKEAGFVGEV  480
LGEDAIDGGR ALLRKYDTNW EMKVEDDNRS VGLWWKGQPV SFCTLWKLDG NDQSSTFTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-4114952784473Protein SHORT-ROOT
5b3h_B1e-4114952730419Protein SHORT-ROOT
5b3h_E1e-4114952730419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0071ss00650.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014516188.10.0scarecrow-like protein 29
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A0L9VQ410.0A0A0L9VQ41_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SZV30.0A0A0S3SZV3_PHAAN; Uncharacterized protein
STRINGXP_007135437.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-148GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]
  3. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]