PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0071ss00630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family GRF
Protein Properties Length: 604aa    MW: 69071.4 Da    PI: 9.8455
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0071ss00630.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.18.9e-25342386145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e 
  Vang0071ss00630.1 342 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV 386
                        79****************************************985 PP

2QLQ53.66.9e-19271306136
                QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                        s+FT++Q+q+L++Q+l++Ky++ + P+Pp+L+  i+
  Vang0071ss00630.1 271 SPFTPSQWQELEQQALVFKYMVTGTPIPPDLIYSIK 306
                        89*****************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.1E-11271307IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.217272307IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.4E-14272305IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.325342386IPR014977WRC domain
PfamPF088796.6E-21343385IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MQSLRLKHEV GEGKNRKRQE EEVNYRDNDE GREVMVKEKN DGSDILKAAG SQGGNSPEIT  60
KMKRGGLKGK AERERQVLSI ASKQPGTSFY PIVFYFHHRS TLLQKVNAFS IMFLNYWRKD  120
GRGYWEEGRQ LRGKGGEIEC NVTENGEMKV RWLGLEVGEN VKKKEKASIR GQKKEDSTLA  180
LASKSINEIM PRMVKPKKIR NDTYETFSYL KSYHPSDCKT KEIDIGTATI ARQLTLHIIG  240
WMTLFSMSDV ETAKAKRQRQ LQRKKQKQQR SPFTPSQWQE LEQQALVFKY MVTGTPIPPD  300
LIYSIKRSLD SSISSRLFPH HPSKSFAVGW GCFEMGFGRK VDPEPGRCRR TDGKKWRCSK  360
EAYPDSKYCE RHMHRGRNRS RKPVEVSSAT STATNTSQTI PSYTRNLSLA NPTITSPSFP  420
FSPLPSSMPC DSQPFSQSYQ NPSLNPFFYA QSTSSRPPDS DFSPQDATTH QLFMDSASYS  480
HDEKDYRHVH GIREDVDERA FFPEASGSAR NYSDSYQPLS MSTYKSYSNS SFQNINDGTN  540
QRQQEQQHCF VLGTDFKSTR PSKEKEAETT SQRPLHRFFG EWPPKNTDSW LDLASNSRIP  600
TDE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253258KAKRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515268.10.0PREDICTED: growth-regulating factor 5
TrEMBLA0A0S3SZU00.0A0A0S3SZU0_PHAAN; Uncharacterized protein
STRINGGLYMA07G04290.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-49growth-regulating factor 5