PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0070s00490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 546aa    MW: 61383.8 Da    PI: 7.4615
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0070s00490.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1344.7e-42243319177
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       +Cqv gC++dls+ k+yh+rhkvC++hsk+++v+v+gleqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  Vang0070s00490.1 243 VCQVYGCNMDLSSSKDYHKRHKVCDAHSKTAKVIVNGLEQRFCQQCSRFHLLAEFDDGKRSCRRRLAGHNERRRKPQ 319
                       6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-34238305IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.795241318IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-40242323IPR004333Transcription factor, SBP-box
PfamPF031109.1E-32244317IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
LSGYFKIPFF WCLVPKKLFR IEPRNSEKAN SFSSTCVSTK LVLHFFLPAD SPLFHSICDF  60
DLIVLMESWS YVPEEKGYLF SDEMDFSLDA FMRSRRTLVE WDNKSNFERD GFNSDREAVK  120
SMEFVDLGFP DLLQKSFHGS QPLETSSYEL NSNSSRRGNS STQVIALDST MGEEESDSKH  180
LSSLVEAKTH DSSLIDLKLG RLADCKGASS DKVAKEGFTL TSINPTTLSK RARTSSLSAQ  240
APVCQVYGCN MDLSSSKDYH KRHKVCDAHS KTAKVIVNGL EQRFCQQCSR FHLLAEFDDG  300
KRSCRRRLAG HNERRRKPQF DYMTGKQHKI LHSYQGTKYL GSSLQNKPQF PFQNIFQSGI  360
LFHGKHAQNS QSGRIKLEED SLYSSQLAAP VTLGQELSSC ALSLLSDQSQ YPSRHAAGNP  420
LAGSRILHGI HIQDRDDLVS QTSLRITSSA DKYAANESFP CNTASKDVIK NQTAPFSNAV  480
HALQDHHGDD ICQPSDLFDI KHRLSSEHGA TVDLFQLSSH LQRVEQQRNS VLVKWENEDY  540
CFPTV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-29235317284squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0070s00490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017427905.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_017427906.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_017427907.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_017427908.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A0L9USY10.0A0A0L9USY1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T2240.0A0A0S3T224_PHAAN; Uncharacterized protein
STRINGXP_007153485.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-64SBP family protein