PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0062ss00080.1
Common NameLR48_Vigan252s001000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family M-type_MADS
Protein Properties Length: 310aa    MW: 35712.5 Da    PI: 6.9059
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0062ss00080.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF528.9e-171151343
                       --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
             SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                       ie +  r++tf kR+ng++KK +E S+LC ++v viif+s+
  Vang0062ss00080.1 11 IEKEKARKTTFQKRKNGLMKKVYEFSTLCSVDVGVIIFASK 51
                       899999********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.184151IPR002100Transcription factor, MADS-box
SMARTSM004327.2E-19161IPR002100Transcription factor, MADS-box
CDDcd001204.83E-21251No hitNo description
SuperFamilySSF554558.5E-21286IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-11323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-181149IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRGRIPMDL IEKEKARKTT FQKRKNGLMK KVYEFSTLCS VDVGVIIFAS KFLDEPEIWP  60
QDPRELKRVI EKYLNTTSDR RPKVYDVEEY FDERMKRIEG EISKVQKGKI QLIYPTWDDS  120
YNTLEEEQLR MFVSILDAKL DACNQRMNMF KRDSKGKVIA ESDNDEALVP YLAPTLGSHL  180
SFMQNMSQTQ VFPTNDNNRV PFYPCHLSQN SLPSLFQLGQ NFTQLIEKNI AVDWNNQVGA  240
SDHRIDTQQE DRTNKNQNPS SCYYDANIQT MQPYNNVALQ TLPAQLQCDA TFQSLSNRPG  300
LALSAKLCH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0062ss00080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017406398.10.0PREDICTED: MADS-box transcription factor 3-like
TrEMBLA0A0L9T6U30.0A0A0L9T6U3_PHAAN; Uncharacterized protein
STRINGXP_007158806.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.15e-24M-type_MADS family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]