PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0057ss00850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 189aa    MW: 21280.3 Da    PI: 5.6742
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0057ss00850.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.84.5e-44291281100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa vhk+FGasnv+k+l++lp e+r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ 
  Vang0057ss00850.1  29 PCASCKLLRRRCTKDCIFAPYFPSNDPQKFALVHKVFGASNVSKMLQELPIEQRADAVSSLVYEAHARVRDPVYGCVGAISYLQNQVSELQM 120
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la++++e
  Vang0057ss00850.1 121 QLAVAQAE 128
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8728129IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-4429126IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MLLSFYSQTK QEILQLPFFS RNQMAGNSPC ASCKLLRRRC TKDCIFAPYF PSNDPQKFAL  60
VHKVFGASNV SKMLQELPIE QRADAVSSLV YEAHARVRDP VYGCVGAISY LQNQVSELQM  120
QLAVAQAEIL CIQMQQEPVM PNPEMENPDQ KSYLLQNELP QFLNYASSSN VIYDAVSRDN  180
IYGHDMVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163576.11e-123hypothetical protein PHAVU_001G245800g
SwissprotQ8LBW38e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0S3S1091e-138A0A0S3S109_PHAAN; Uncharacterized protein
STRINGGLYMA18G02780.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.18e-69LBD family protein