PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0057ss00850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 189aa    MW: 21280.3 Da    PI: 5.6742
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0057ss00850.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.84.5e-44291281100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa vhk+FGasnv+k+l++lp e+r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ 
  Vang0057ss00850.1  29 PCASCKLLRRRCTKDCIFAPYFPSNDPQKFALVHKVFGASNVSKMLQELPIEQRADAVSSLVYEAHARVRDPVYGCVGAISYLQNQVSELQM 120
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la++++e
  Vang0057ss00850.1 121 QLAVAQAE 128
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8728129IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-4429126IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MLLSFYSQTK QEILQLPFFS RNQMAGNSPC ASCKLLRRRC TKDCIFAPYF PSNDPQKFAL  60
VHKVFGASNV SKMLQELPIE QRADAVSSLV YEAHARVRDP VYGCVGAISY LQNQVSELQM  120
QLAVAQAEIL CIQMQQEPVM PNPEMENPDQ KSYLLQNELP QFLNYASSSN VIYDAVSRDN  180
IYGHDMVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-47251307112LOB family transfactor Ramosa2.1
5ly0_B2e-47251307112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0057ss00850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493648.21e-136LOB domain-containing protein 12 isoform X1
SwissprotQ8LBW31e-70LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0S3S1091e-136A0A0S3S109_PHAAN; Uncharacterized protein
STRINGXP_007163576.11e-123(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.18e-69LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]