PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0053ss00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family M-type_MADS
Protein Properties Length: 381aa    MW: 43467.6 Da    PI: 6.2419
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0053ss00150.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.18.1e-1268108141
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
             SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41 
                        k+i+n++ r++tf +R++g++KK +E S  C+ e ++i++ 
  Vang0053ss00150.1  68 KQISNERSRKTTFLRRKTGLMKKISEFSKRCGGEHCLIMYD 108
                        68*************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.18E-1460139IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.30160110IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-960121IPR002100Transcription factor, MADS-box
PRINTSPR004049.1E-66282IPR002100Transcription factor, MADS-box
PfamPF003191.4E-1270110IPR002100Transcription factor, MADS-box
PRINTSPR004049.1E-68297IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MLLVDNFIHA DMHPTNILVR VAQRKSRKRL FKSKPHVVFL DVVLSVAIEL FLVCAVLQNM  60
GRARITLKQI SNERSRKTTF LRRKTGLMKK ISEFSKRCGG EHCLIMYDDN ADGDVEAVTS  120
PENPVEIHSM IQKYYETQLK KERPHKTYGI EEFFKNRKKM IEAEISKVHK QISSIKYPTW  180
DPSFVNMEED QLRALCARVE AKIEACDEGI KLLKNHKNVP SLMQNFSHGQ IIQTPIQALD  240
NEISYLLRNM QEGGGDDAWF SFVPNMAQEN ATATTSHPNQ VNCLQNISQS QPLLEDFMEL  300
YDKNYEAVDV PLNSINLFSE LEVEELIREL SNEGCDNPVG FSSQPHESIL PSISAEYQNQ  360
HQGGGPLNAL PQTNYYDMLF *
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0053ss00150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027925169.11e-157agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A0L9VMF90.0A0A0L9VMF9_PHAAN; Uncharacterized protein
STRINGXP_007151607.11e-131(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.17e-19M-type_MADS family protein