PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0032ss01930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 390aa    MW: 43342.9 Da    PI: 7.9182
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0032ss01930.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.31.7e-334296155
            G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                       kprl+Wtp+LH+rF+eav+qLGG++kAtPkt+++lm++ gLtl+h+kSHLQkYRl
  Vang0032ss01930.1 42 KPRLKWTPDLHARFIEAVQQLGGADKATPKTVMKLMGISGLTLYHLKSHLQKYRL 96
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.5083999IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-314097IPR009057Homeodomain-like
SuperFamilySSF466896.27E-164197IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-234297IPR006447Myb domain, plants
PfamPF002491.7E-94495IPR001005SANT/Myb domain
PfamPF143791.5E-22146192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
LQHQGKNIHS SSRMPIPSER HMFLHTGNGS GDSSLVLSTD AKPRLKWTPD LHARFIEAVQ  60
QLGGADKATP KTVMKLMGIS GLTLYHLKSH LQKYRLSKSL HGQSNNVTHK ISINPGAATD  120
ERLRENNGTH VNNLNLAPQS NNKDLHISEA LQMQIEVQRR LNEQLEVQRL LQLRIEAQGK  180
YLQAVLEKAQ ETLGRQNLGV VGLEAAKLQL SDLVSKVSSQ CLNSAFLELK ELQGFSPHQT  240
QTNQPNDCSM DSCLTSCEVS QKEQEIQNGG MSLRPFNVHT FMERKELIEG PNLNNLPSTD  300
LKWCDPVKNT FLTPLSRRSP SNLSMSIGLE GETENGSTIR KESVKSVAEK VSQDYGLPSY  360
FAAPNLDLTT EDKNNRSCKE LDLNGFSWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-204198158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-204198158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-204198158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-204198158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-204198158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-204198158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-204198158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-204198158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0032ss01930.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027909406.10.0myb-related protein 2-like
SwissprotQ9SQQ91e-130PHL9_ARATH; Myb-related protein 2
TrEMBLA0A4D6LHJ90.0A0A4D6LHJ9_VIGUN; Two-component response regulator ARR-B family
STRINGXP_007132437.10.0(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-119G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]