PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0021ss01400.1
Common NameLR48_Vigan05g188500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family WOX
Protein Properties Length: 198aa    MW: 22487.5 Da    PI: 10.2011
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0021ss01400.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.2e-191877357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       +R+++t+eq+  Le+l+++  r+p+ae+++e +++l    +++ ++V++WFqN++a++++
  Vang0021ss01400.1 18 SRWSPTREQIAMLEDLYRQgMRTPNAEQIQEVTSRLraygHIQGKNVFYWFQNHKARQRQ 77
                       6*****************99**************************************97 PP

2Wus_type_Homeobox112.91.6e-361779365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +RW+Pt eQi +Le+ly++G+rtPn+e+iq++t++L++yG+i++kNVfyWFQN+kaR+rqkq
  Vang0021ss01400.1 17 VSRWSPTREQIAMLEDLYRQGMRTPNAEQIQEVTSRLRAYGHIQGKNVFYWFQNHKARQRQKQ 79
                       68***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.59E-121286IPR009057Homeodomain-like
PROSITE profilePS5007111.0461378IPR001356Homeobox domain
SMARTSM003891.0E-51582IPR001356Homeobox domain
PfamPF000462.2E-171877IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.3E-81877IPR009057Homeodomain-like
CDDcd000861.32E-41979No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGSRSAMRRE PSRTHSVSRW SPTREQIAML EDLYRQGMRT PNAEQIQEVT SRLRAYGHIQ  60
GKNVFYWFQN HKARQRQKQK LESIAYSNSF LQASHPICQN VVCAPFYPQQ SGMNFYPQPE  120
KVVATGGIVG TVVPFGMLKI CDGQQIYQQL RQRVQPDYNY SINDKKTLNL FPLHPTGILK  180
EKTVNQGSSH ASASGCH*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0021ss01400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-167AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017423722.11e-148PREDICTED: WUSCHEL-related homeobox 2-like
SwissprotQ6X7K16e-39WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A0L9UN031e-147A0A0L9UN03_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SGD41e-147A0A0S3SGD4_PHAAN; Uncharacterized protein
STRINGGLYMA13G41000.14e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-41WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  2. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]
  3. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce.
    BMC Plant Biol., 2016. 16: p. 19
    [PMID:26786587]
  4. Zhang Z,Tucker E,Hermann M,Laux T
    A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells.
    Dev. Cell, 2017. 40(3): p. 264-277.e4
    [PMID:28171749]