PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0021ss00470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 437aa    MW: 49312.4 Da    PI: 8.4064
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0021ss00470.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.4e-3362116155
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        kprl+Wt +LH+rF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Vang0021ss00470.1  62 KPRLKWTADLHARFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 116
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.03359119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-3060117IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1661117IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2262117IPR006447Myb domain, plants
PfamPF002497.5E-964115IPR001005SANT/Myb domain
PfamPF143792.0E-24163209IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MENGTRKWGP LVNKSGMYHH HQHQGKNIHS SSRMPIPSER HMFLQTGNGS GDSGLVLSTD  60
AKPRLKWTAD LHARFIEAVN QLGGADKATP KTVMKLMGIP GLTLYHLKSH LQKYRLSKNL  120
HGQSNTVTHK MTTSAATGER LSETSGTHMN KLSLGPQANK DLHISEALQM QIEVQRRLNE  180
QLEVQRHLQL RIEAQGKYLQ SVLEKAQETL GRQNLGIVGL ETAKVQLSEL VSKVSSQCLN  240
SAFSELKELQ GFCPQQTHTN QPNDCSVDSC LTSCDRSQKE QEIQNGFRHF NSHMFMEQKE  300
ATEAPNNLRN CELKWCDDGK KNTFLAPLSR NEERRNYAAE TGPGNLSMSI GLERETENRS  360
SMYPERLITE NQSEGEFQHR NRIKTETMKP VDEKVSQDYR MPASYFVAAR LDLNNHGDNE  420
AATTCKQLDL NRFSWS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-1861118158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-1861118158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1862118157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1862118157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1862118157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1862118157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-1861118158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-1861118158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-1861118158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-1861118158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-1861118158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-1861118158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0021ss00470.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017424137.10.0PREDICTED: myb-related protein 2-like
SwissprotQ9SQQ91e-142PHL9_ARATH; Myb-related protein 2
TrEMBLA0A0S3SH070.0A0A0S3SH07_PHAAN; Uncharacterized protein
STRINGXP_007150070.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-145G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]