PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0013ss00740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family G2-like
Protein Properties Length: 409aa    MW: 46917 Da    PI: 8.9196
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0013ss00740.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-3197150255
            G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        prlrWtpeLH +Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Vang0013ss00740.1  97 PRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 150
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-3093151IPR009057Homeodomain-like
PROSITE profilePS5129412.21893153IPR017930Myb domain
SuperFamilySSF466898.78E-1595151IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-2297152IPR006447Myb domain, plants
PfamPF002493.1E-998149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
LKWELNLIPE QQQTNMSDEY EMSDEQVEDS SIGSSQKCSS FDLNEEASSE NNSKGNDTRY  60
EEAKDEGTST NKSSSITREG NSERRGGVRQ YVRSKMPRLR WTPELHLSFV HAVERLGGQE  120
RATPKLVLQL MNVRGLSIAH VKSHLQMYRS KKLDEAGQVL SETYKSSHEL GRISHVTHPR  180
QHFKMGNGGI ILASDYTDHS YYHGLLHPSN LSHSHSKAID SRHQQWFFNN HQPFRKPSYF  240
SNEVGSATLQ TQARSMSSNQ IQVMDATSIA PMRPSQFLEE KRWPPLEIMN NHPWKKRLPS  300
NTDSKSVLLH QFGSTTSPSL RPTELNFPNK TRIREHLSNS DEHRSYSNAF NPEFEPPFRI  360
KSNQEKMQKE KQWVPDLRLS LSQRDGNSDG KNDHCRETQE INTKLSLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1798152458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1798152458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1798152357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1798152357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1798152357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1798152357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1798152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1798152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1798152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1798152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1798152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1798152458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0013ss00740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017431888.10.0PREDICTED: two-component response regulator ARR18-like
TrEMBLA0A0S3QZ880.0A0A0S3QZ88_PHAAN; Uncharacterized protein
STRINGXP_007159455.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-37G2-like family protein